Navigation Links
Ribonucleic acid, transfer from baker's yeast (S. cerevisiae) from Sigma-Aldrich

ProductsRibonucleic acid, transfer from baker's yeast (S. cerevisiae) from Sigma-Aldrich
Company Sigma-Aldrich
Item Ribonucleic acid, transfer from baker's yeast (S. cerevisiae)
Price 
Description Application: For use as a carrier in nucleic acid purification and precipitation.
Physical form: Solution in 10 mM Tris HCl, pH 7.4, 1 mM EDTA
Concentration: 9-11 mg/mL
Physical Form: buffered aqueous solution
Info Sigma-AldrichSigma-Aldrich
Sigma-Aldrich Corp.
St. Louis, MO, USA
Customer Service: 800-325-3010
Tech Support: 800-325-5832
Fax Number: 314-771-5757
Web Site: http://www.sigmaaldrich.com/
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Ribonucleic acid, transfer from bakers yeast (S. cerevisiae) from Sigma-Aldrich
2. Ribonucleic acid, transfer from bakers yeast (S. cerevisiae) from Sigma-Aldrich
3. Ribonucleic acid, transfer from bakers yeast (S. cerevisiae) from Sigma-Aldrich
4. Ribonucleic acid, transfer, phenylalanine specific from brewers yeast from Sigma-Aldrich
5. Ribonucleic acid, transfer from bakers yeast (S. cerevisiae) from Sigma-Aldrich
6. DNP-X acid, SE -- [6-(2,4-Dinitrophenyl)aminohexanoic acid, succinimidyl ester] from AnaSpec
7. 6-(2,4-dinitrophenyl)aminohexanoic acid, succinimidyl ester (DNP-X, SE) from Molecular Probes (Invitrogen)
8. Mouse Anti-Mouse Glutathione S-transferase M1 (GSTM1) Monoclonal Antibody, Unconjugated from Lifespan Biosciences
9. Terminal deoxynucleotidyl transferase (TdT) Immunofluorescence Assay Kit from AbD Serotec
10. Guanylyltransferase (5 U/l) from Ambion
11. Mouse Anti-Chloramphenicol Acetyltransferase Monoclonal Antibody, Unconjugated from Novus Biologicals
... Mouse monoclonal antibody raised ... Immunogen: ... 206 a.a) partial recombinant protein ... Accession Number: NM_005802 ...
Mouse monoclonal antibody raised against a full length recombinant SNAPC5. NCBI Entrez Gene ID = SNAPC5...
... monoclonal antibody raised against a partial recombinant NFKBIB. ... a.a. ~ 145 a.a) partial recombinant protein with ... EDGDTALHLAVIHQHEPFLDFLLGFSAGTEYMDLQNDLGQTALHLAAILGETSTVEKLYAAGAGLCVAERRGHTALHLACRVGAHACARA Accession: BC015528 ... OMIM: 604495, ...
... Perm/Wash Buffer I can be used in ... to permeabilize cells and to serve as ... Because saponin-mediated cell permeabilization is a reversible ... cells in the presence of saponin during ...
Biology Products:
(Date:5/23/2017)...  Hunova, the first robotic gym for the rehabilitation and functional motor ... Genoa, Italy . The first 30 robots will be ... USA . The technology was developed and patented at the ... spin-off Movendo Technology thanks to a 10 million euro investment from entrepreneur ... ...
(Date:4/19/2017)... 2017 The global military biometrics ... marked by the presence of several large global players. ... five major players - 3M Cogent, NEC Corporation, M2SYS ... nearly 61% of the global military biometric market in ... global military biometrics market boast global presence, which has ...
(Date:4/11/2017)... April 11, 2017 Crossmatch®, a globally-recognized ... solutions, today announced that it has been awarded ... Projects Activity (IARPA) to develop next-generation Presentation Attack ... "Innovation has been a driving force within ... will allow us to innovate and develop new ...
Breaking Biology News(10 mins):
(Date:8/11/2017)... ... ... Algenist continues to disrupt the skincare industry with today’s debut of GENIUS Liquid ... the key structural element skin needs to maintain its youthful appearance and Algenist is ... First to market with proprietary collagen water active , Active ...
(Date:8/10/2017)... ... August 09, 2017 , ... Teachers from three Philadelphia middle ... 14th through the 16th, the University City Science Center will kick off the ... provides Philadelphia-based middle school educators an opportunity for professional development related to STEM ...
(Date:8/10/2017)... ... August 09, 2017 , ... Okyanos Center for Regenerative Medicine has announced its ... Hotel in Freeport, Grand Bahama on September 27, 2017. This daytime event is free ... from the Ministry of Health’s National Stem Cell Ethics Committee (NSCEC) and regulations laid ...
(Date:8/10/2017)... USA, and CARDIFF, UK (PRWEB) , ... August ... ... and photonics, has announced an agreement establishing Kinokuniya Company Ltd. as its exclusive ... SPIE as the exclusive sales representative for the SPIE Digital Library in Japan. ...
Breaking Biology Technology: