Navigation Links
Revco ULT and SI freezers from Thermo Scientific

ProductsRevco ULT and SI freezers from Thermo Scientific
Company Thermo Scientific
Item Revco ULT and SI freezers
Price 
Description Ultra low freezers

Ultima II Series
Developed for the most critical material storage, Ultima II represents the finest, most enhanced ultra-low freezer anywhere. Available in general purpose and blood bank configurations, each Ultima II freezer includes the Revco IntrLogic microprocessor control system with built-in voltage boost and surge suppressor, convenience eye-level controls on upright models and comprehensive monitoring technology such as Lifeguard compressor protection, A.I.M. incident monitor, and extreme ambient alert.

Elite Series
Built to meet high standards for performance and safety, Revco Elite Series ultra-low Freezers include microprocessor controls, alarm/monitor systems, and regged cabinet construction found throughout the entire Revco freezer product line.

Value Series
A cost-effective alternative for a variety of industrial process and non-critical storage uses, the Revco Value Series incorporates Legaci refrigeration with Ultima II quality cabinet construction and a reliable solid-state control for basic but dependable operation.

Super insulation
Available in a variety of sizes and control configurations, REVCO Super Insulation (SI) -86C ultra-low temperature upright freezers set the standard for capacity and floor space efficiency in critical material storage.

REVCO SI freezers employ a composite thin wall design to increase interior capacity. Highly efficient thin wall Super Insulation decreases the wall thickness from 5" (127 mm) on conventional ultra-lows to just 2 5/8' (67 mm), maximizing the space available for sample storage.

The result: REVCO SI freezers offer significantly more storage capacity than conventional insulated models with an equivalent freezer footprint.
Info Thermo ScientificThermo Scientific
450 Fortune Blvd.
Milford, MA 01757
Customer Service: North America: 1-877-THERMO-U
Fax Number: 508-520-2229
Web Site: http://www.thermo.com
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Jewett plasma and blood bank freezers from Thermo Scientific
2. HERAfreeze -86C chest and upright freezers from Thermo Scientific
3. Thermo Sequenase Dye Primer Manual Cycle Sequencing Kit from USB Corp.
4. Finnigan Pocket Surveyor from Thermo Scientific
5. DSQ II Single Quadrupole GC/MS from Thermo Scientific
6. LXQ High Throughput Linear Ion Trap from Thermo Scientific
7. LTQ XL Linear Ion Trap from Thermo Scientific
8. Thermo-Fast 96 PCR Plate, Non-Skirted from ABgene
9. ChromQuest is a powerful and flexible Chromatography Data System (CDS) from Thermo Scientific
10. Thermostable dUTPase from GenScript Corporation
11. TSQ Quantum Ultra from Thermo Scientific
Mouse monoclonal antibody raised against a full length recombinant SNAPC5. NCBI Entrez Gene ID = SNAPC5...
Agarose II (Low Melt)...
... monoclonal antibody raised against a partial recombinant NFKBIB. ... a.a. ~ 145 a.a) partial recombinant protein with ... EDGDTALHLAVIHQHEPFLDFLLGFSAGTEYMDLQNDLGQTALHLAAILGETSTVEKLYAAGAGLCVAERRGHTALHLACRVGAHACARA Accession: BC015528 ... OMIM: 604495, ...
Mouse monoclonal antibody raised against a partial recombinant CRKRS. NCBI Entrez Gene ID = CRKRS...
Biology Products:
(Date:5/6/2017)... , May 5, 2017 RAM ... announced a new breakthrough in biometric authentication based ... quantum mechanical properties to perform biometric authentication. These new ... semiconductor material created by Ram Group and its ... entertainment, transportation, supply chains and security. Ram Group ...
(Date:4/19/2017)... April 19, 2017 The global ... landscape is marked by the presence of several large ... held by five major players - 3M Cogent, NEC ... accounted for nearly 61% of the global military biometric ... in the global military biometrics market boast global presence, ...
(Date:4/17/2017)... Florida , April 17, 2017 NXT-ID, ... technology company, announces the filing of its 2016 Annual Report on ... and Exchange Commission. ... on Form 10-K is available in the Investor Relations section of ... as on the SEC,s website at http://www.sec.gov . ...
Breaking Biology News(10 mins):
(Date:10/11/2017)... (PRWEB) , ... October 11, 2017 , ... ComplianceOnline’s Medical ... place on 7th and 8th June 2018 in San Francisco, CA. The Summit brings ... well as several distinguished CEOs, board directors and government officials from around the world ...
(Date:10/11/2017)... the Netherlands and LAGUNA HILLS, Calif. ... The Institute of Cancer Research, London ... use MMprofiler™ with SKY92, SkylineDx,s prognostic tool to risk-stratify patients ... trial known as MUK nine . The University of ... trial, which is partly funded by Myeloma UK, and ICR ...
(Date:10/11/2017)... , ... October 11, 2017 , ... ... (FDA) has granted orphan drug designation to SBT-100, its novel anti-STAT3 (Signal Transducer ... treatment of osteosarcoma. SBT-100 is able to cross the cell membrane and bind ...
(Date:10/10/2017)... ... October 10, 2017 , ... For ... has won a US2020 STEM Mentoring Award. Representatives of the FirstHand program travelled ... Volunteer Experience from US2020. , US2020’s mission is to change the trajectory of ...
Breaking Biology Technology: