Navigation Links
ReadyPrep Overlay Agarose, 50 ml from Bio-Rad

ProductsReadyPrep Overlay Agarose, 50 ml from Bio-Rad
Company Bio-Rad
Item ReadyPrep Overlay Agarose, 50 ml
Price 
Description ReadyPrep overlay agarose, is a low melting point agarose used for second-dimension SDS-PAGE sample setup to secure IPG strips in place for most applications. Bromophenol Blue tracking dye is incorporated to allow monitoring of electrophoresis runs. The solution is composed of 0.5% low melting point agarose in 1x Tris, glycine, SDS, and 0.003% Bromophenol Blue and is supplied as 50 ml.
Info Bio-RadBio-Rad
Bio-Rad Laboratories, Inc.
Life Science Research Group
2000 Alfred Nobel Drive
Hercules, CA 94547
USA
Customer Service: 800-424 6723
Fax Number: 800-879 2289
Web Site: http://discover.bio-rad.com
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. ReadyPrep 2-D Starter Kit from Bio-Rad
2. ReadyPrep 2-D Cleanup Kit from Bio-Rad
3. PROTEAN Plus Overlay Agarose, 125 ml from Bio-Rad
4. Zero -mr Agarose, 10 g from Bio-Rad
5. CleanCut Agarose, 2%, 12 ml from Bio-Rad
6. Agarose, pulse field from GE Healthcare, formerly Amersham Biosciences
7. Agarose, pulse field from GE Healthcare, formerly Amersham Biosciences
8. Agarose, low melting/gelling temperature high MW separation (> 1000 bp) from GE Healthcare, formerly Amersham Biosciences
9. Agarose, high EEO, Molecular Biology Grade from Research Organics, Inc.
10. Agarose, high EEO, Molecular Biology Grade from Research Organics, Inc.
11. Agarose, high gelling temperature, Molecular Biology Grade from Research Organics, Inc.
... Mouse monoclonal antibody raised ... Immunogen: ... 206 a.a) partial recombinant protein ... Accession Number: NM_005802 ...
Mouse monoclonal antibody raised against a full length recombinant SNAPC5. NCBI Entrez Gene ID = SNAPC5...
... monoclonal antibody raised against a partial recombinant NFKBIB. ... a.a. ~ 145 a.a) partial recombinant protein with ... EDGDTALHLAVIHQHEPFLDFLLGFSAGTEYMDLQNDLGQTALHLAAILGETSTVEKLYAAGAGLCVAERRGHTALHLACRVGAHACARA Accession: BC015528 ... OMIM: 604495, ...
... Perm/Wash Buffer I can be used in ... to permeabilize cells and to serve as ... Because saponin-mediated cell permeabilization is a reversible ... cells in the presence of saponin during ...
Biology Products:
(Date:5/23/2017)...  Hunova, the first robotic gym for the rehabilitation and functional motor ... Genoa, Italy . The first 30 robots will be ... USA . The technology was developed and patented at the ... spin-off Movendo Technology thanks to a 10 million euro investment from entrepreneur ... ...
(Date:4/19/2017)... 2017 The global military biometrics ... marked by the presence of several large global players. ... five major players - 3M Cogent, NEC Corporation, M2SYS ... nearly 61% of the global military biometric market in ... global military biometrics market boast global presence, which has ...
(Date:4/11/2017)... April 11, 2017 Crossmatch®, a globally-recognized ... solutions, today announced that it has been awarded ... Projects Activity (IARPA) to develop next-generation Presentation Attack ... "Innovation has been a driving force within ... will allow us to innovate and develop new ...
Breaking Biology News(10 mins):
(Date:8/11/2017)... ... ... Algenist continues to disrupt the skincare industry with today’s debut of GENIUS Liquid ... the key structural element skin needs to maintain its youthful appearance and Algenist is ... First to market with proprietary collagen water active , Active ...
(Date:8/10/2017)... ... August 09, 2017 , ... Teachers from three Philadelphia middle ... 14th through the 16th, the University City Science Center will kick off the ... provides Philadelphia-based middle school educators an opportunity for professional development related to STEM ...
(Date:8/10/2017)... ... August 09, 2017 , ... Okyanos Center for Regenerative Medicine has announced its ... Hotel in Freeport, Grand Bahama on September 27, 2017. This daytime event is free ... from the Ministry of Health’s National Stem Cell Ethics Committee (NSCEC) and regulations laid ...
(Date:8/10/2017)... USA, and CARDIFF, UK (PRWEB) , ... August ... ... and photonics, has announced an agreement establishing Kinokuniya Company Ltd. as its exclusive ... SPIE as the exclusive sales representative for the SPIE Digital Library in Japan. ...
Breaking Biology Technology: