Navigation Links
RayBio Human Inflammation Antibody Array III & 3.1 Service from Raybiotech, Inc.
Mouse monoclonal antibody raised against a partial recombinant IL31RA. NCBI Entrez Gene ID = IL31RA...
... raised against a partial recombinant NFKBIB. ... 145 a.a) partial recombinant protein with GST tag. ... Accession: BC015528 ... OMIM: 604495, GeneID: ...
... Mouse polyclonal antibody raised against a partial ... FES (AAH35357, 120 a.a. ~ 250 a.a) ... Protein Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA ... Protein Accession Number: AAH35357 ...
Mouse polyclonal antibody raised against a partial recombinant PREB. NCBI Entrez Gene ID = 10113...
Biology Products:
(Date:5/16/2017)... DALLAS , May 16, 2017   ... for health organizations, and MD EMR Systems ... certified development partner for GE, have established a ... Patient Portal product and the GE Centricity™ products, ... Centricity EMR. These new integrations ...
(Date:4/17/2017)... , April 17, 2017 NXT-ID, Inc. ... company, announces the filing of its 2016 Annual Report on Form ... Exchange Commission. ... Form 10-K is available in the Investor Relations section of the ... on the SEC,s website at http://www.sec.gov . 2016 ...
(Date:4/11/2017)... , April 11, 2017 No two ... researchers at the New York University Tandon School ... Engineering have found that partial similarities between prints ... used in mobile phones and other electronic devices ... The vulnerability lies in the fact that ...
Breaking Biology News(10 mins):
(Date:5/24/2017)... As Ebola resurfaces in the Democratic ... suspected cases now reported, a new analysis of the Ebola ... correlation between the 2014 and 2017 outbreaks of the disease.  ... 2012-13, which preceded the 2014 outbreak. An analysis of the ... counts in 2014-15, which again precedes the current outbreak in ...
(Date:5/23/2017)... , ... May 22, 2017 , ... ... in a row in the Aragon Research Globe™ for Corporate Learning, 2017. , ... industry direction and market demand, and effectively perform against those strategies. NetDimensions’ ranking ...
(Date:5/23/2017)... (PRWEB) , ... May 23, 2017 , ... Bacterial biofilms, ... polymeric molecules, can cause diverse pathologies ranging from food poisoning and catheter infections to ... biofilms is in the tens of billions of dollars per year, there is currently ...
(Date:5/22/2017)... ... 2017 , ... Cancer diagnostics and pathology workflow solution provider ... Association for Pathology Informatics Annual Summit at the Wyndham Grand Hotel ... Diagnostic Cockpit and Consultation Portal, Inspirata will present research it led to help ...
Breaking Biology Technology: