Navigation Links
Rabbit anti-UBAP2L/NICE4 AbVantage Pack Polyclonal Antibody, Unconjugated from Bethyl Laboratories

ProductsRabbit anti-UBAP2L/NICE4 AbVantage Pack Polyclonal Antibody, Unconjugated from Bethyl Laboratories
Company Bethyl Laboratories
Item Rabbit anti-UBAP2L/NICE4 AbVantage Pack Polyclonal Antibody, Unconjugated
Price $350.00
Description Antibodies were affinity purified using epitopes specific to UBAP2L/NICE4 immobilized on solid support.
Info Bethyl LaboratoriesBethyl Laboratories
Bethyl Laboratories
P.O. Box 850
Montgomery, TX 77356
Customer Service: 800-338-9579
Fax Number: 936-597-6105
Web Site: http://www.bethyl.com
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Rabbit Anti-Aph-1aL, S Loop (92-115) Polyclonal Antibody, Unconjugated from Covance Research Products, Inc
2. Rabbit Anti-Human Vitamin K-dependent Protein S (PROS1) Polyclonal Antibody, Unconjugated from Lifespan Biosciences
3. Rabbit Anti-Human Sirtuin (silent mating type information regulation 2, S.cerevisiae, homolog) 7 (SIRT7) Polyclonal Antibody, Unconjugated from Lifespan Biosciences
4. Rabbit Anti-Esa1 Polyclonal Antibody, Unconjugated from Abcam
5. Rabbit Anti-Human Rad51 Polyclonal Antibody, Unconjugated from Abcam
6. Human CALCA EIA (Enzyme immunoassay) Kit, Host: Rabbit ; Extraction-free from BACHEM
7. MaxArray Tissue Array (Animal - Rabbit) from Invitrogen
8. Rabbit Anti-GST Polyclonal Antibody, Unconjugated from Novus Biologicals
9. Rabbit Anti-Shigella Polyclonal Antibody, Unconjugated from GeneTex
10. Vaginal Keratinocyte Progenitors, Rabbit from CHEMICON
11. Dermal Fibroblasts, Rabbit from CHEMICON
... antibody raised against a partial recombinant FES. ... 120 a.a. ~ 250 a.a) partial recombinant ... Protein Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA ... Accession Number: AAH35357 ...
... Mouse polyclonal antibody raised against ... Immunogen: PPP4C ... a.a) partial recombinant protein with ... Accession Number: NM_002720 ...
Mouse monoclonal antibody raised against a partial recombinant CAPG. NCBI Entrez Gene ID = CAPG...
...
Biology Products:
(Date:4/28/2016)... , April 28, 2016 First quarter ... (139.9), up 966% compared with the first quarter of 2015 ... totaled SEK 589.1 M (loss: 18.8) and the operating margin was ... (loss: 0.32) Cash flow from operations was SEK 249.9 ... 2016 revenue guidance is unchanged, SEK 7,000-8,500 M. The ...
(Date:4/19/2016)... , UAE, April 20, 2016 ... implemented as a compact web-based "all-in-one" system solution for ... biometric fingerprint reader or the door interface with integration ... modern access control systems. The minimal dimensions of the ... readers into the building installations offer considerable freedom of ...
(Date:4/14/2016)... , April 14, 2016 ... Malware Detection, today announced the appointment of Eyal ... new role. Goldwerger,s leadership appointment comes at ... heels of the deployment of its platform at several ... biometric technology, which discerns unique cognitive and physiological factors, ...
Breaking Biology News(10 mins):
(Date:6/27/2016)... ... June 27, 2016 , ... Rolf K. Hoffmann, former ... of the University of North Carolina Kenan-Flagler Business School effective June ... UNC Kenan-Flagler, with a focus on the school’s international efforts, leading classes and ...
(Date:6/24/2016)... Brooklyn, NY (PRWEB) , ... June 24, 2016 , ... ... 15mm, machines such as the Cary 5000 and the 6000i models are higher end ... height is the height of the spectrophotometer’s light beam from the bottom of the ...
(Date:6/23/2016)... 2016 /PRNewswire/ - FACIT has announced the creation ... biotechnology company, Propellon Therapeutics Inc. ("Propellon" or "the ... a portfolio of first-in-class WDR5 inhibitors for the ... WDR5 represent an exciting class of therapies, possessing ... for cancer patients. Substantial advances have been achieved ...
(Date:6/23/2016)... , June, 23, 2016  The Biodesign Challenge (BDC), ... new ways to harness living systems and biotechnology, announced ... (MoMA) in New York City . ... participating students, showcased projects at MoMA,s Celeste Bartos Theater ... Antonelli , MoMA,s senior curator of architecture and design, ...
Breaking Biology Technology: