Navigation Links
Rabbit Anti-Human NCF2 Polyclonal Antibody, Unconjugated from Atlas Antibodies

ProductsRabbit Anti-Human NCF2 Polyclonal Antibody, Unconjugated from Atlas Antibodies
Company Atlas Antibodies
Item Rabbit Anti-Human NCF2 Polyclonal Antibody, Unconjugated
Price $350.00
Description Neutrophil cytosol factor 2 (NCF-2) (Neutrophil NADPH oxidase factor 2) (67 kDa neutrophil oxidase factor) (p67-phox) (NOXA2). [Source:Uniprot/SWISSPROT;Acc:P19878]
Antigen: Recombinant Protein Epitope Signature Tag (PrEST).
Info Atlas AntibodiesAtlas Antibodies
AlbaNova University Center
SE-106 91 Stockholm, Sweden
Customer Service: +46 8 54 59 58 50
Fax Number: +46 8 54 59 58 51
Web Site: http://www.atlasantibodies.com
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Rabbit Anti-Aph-1aL, S Loop (92-115) Polyclonal Antibody, Unconjugated from Covance Research Products, Inc
2. Rabbit Anti-Human Vitamin K-dependent Protein S (PROS1) Polyclonal Antibody, Unconjugated from Lifespan Biosciences
3. Rabbit Anti-Human Sirtuin (silent mating type information regulation 2, S.cerevisiae, homolog) 7 (SIRT7) Polyclonal Antibody, Unconjugated from Lifespan Biosciences
4. Rabbit Anti-Esa1 Polyclonal Antibody, Unconjugated from Abcam
5. Rabbit Anti-Human Rad51 Polyclonal Antibody, Unconjugated from Abcam
6. Human CALCA EIA (Enzyme immunoassay) Kit, Host: Rabbit ; Extraction-free from BACHEM
7. MaxArray Tissue Array (Animal - Rabbit) from Invitrogen
8. Rabbit Anti-GST Polyclonal Antibody, Unconjugated from Novus Biologicals
9. Rabbit Anti-Shigella Polyclonal Antibody, Unconjugated from GeneTex
10. Vaginal Keratinocyte Progenitors, Rabbit from CHEMICON
11. Dermal Fibroblasts, Rabbit from CHEMICON
... Mouse monoclonal antibody raised ... Immunogen: ... 206 a.a) partial recombinant protein ... Accession Number: NM_005802 ...
Mouse monoclonal antibody raised against a full length recombinant SNAPC5. NCBI Entrez Gene ID = SNAPC5...
... monoclonal antibody raised against a partial recombinant NFKBIB. ... a.a. ~ 145 a.a) partial recombinant protein with ... EDGDTALHLAVIHQHEPFLDFLLGFSAGTEYMDLQNDLGQTALHLAAILGETSTVEKLYAAGAGLCVAERRGHTALHLACRVGAHACARA Accession: BC015528 ... OMIM: 604495, ...
... Perm/Wash Buffer I can be used in ... to permeabilize cells and to serve as ... Because saponin-mediated cell permeabilization is a reversible ... cells in the presence of saponin during ...
Biology Products:
(Date:5/23/2017)...  Hunova, the first robotic gym for the rehabilitation and functional motor ... Genoa, Italy . The first 30 robots will be ... USA . The technology was developed and patented at the ... spin-off Movendo Technology thanks to a 10 million euro investment from entrepreneur ... ...
(Date:4/19/2017)... 2017 The global military biometrics ... marked by the presence of several large global players. ... five major players - 3M Cogent, NEC Corporation, M2SYS ... nearly 61% of the global military biometric market in ... global military biometrics market boast global presence, which has ...
(Date:4/11/2017)... April 11, 2017 Crossmatch®, a globally-recognized ... solutions, today announced that it has been awarded ... Projects Activity (IARPA) to develop next-generation Presentation Attack ... "Innovation has been a driving force within ... will allow us to innovate and develop new ...
Breaking Biology News(10 mins):
(Date:8/11/2017)... ... ... Algenist continues to disrupt the skincare industry with today’s debut of GENIUS Liquid ... the key structural element skin needs to maintain its youthful appearance and Algenist is ... First to market with proprietary collagen water active , Active ...
(Date:8/10/2017)... ... August 09, 2017 , ... Teachers from three Philadelphia middle ... 14th through the 16th, the University City Science Center will kick off the ... provides Philadelphia-based middle school educators an opportunity for professional development related to STEM ...
(Date:8/10/2017)... ... August 09, 2017 , ... Okyanos Center for Regenerative Medicine has announced its ... Hotel in Freeport, Grand Bahama on September 27, 2017. This daytime event is free ... from the Ministry of Health’s National Stem Cell Ethics Committee (NSCEC) and regulations laid ...
(Date:8/10/2017)... USA, and CARDIFF, UK (PRWEB) , ... August ... ... and photonics, has announced an agreement establishing Kinokuniya Company Ltd. as its exclusive ... SPIE as the exclusive sales representative for the SPIE Digital Library in Japan. ...
Breaking Biology Technology: