Navigation Links
Rabbit Anti-Bacillus anthracis (Anthrax) Spore Antigen Antibody, Unconjugated from HyTest Ltd.

ProductsRabbit Anti-Bacillus anthracis (Anthrax) Spore Antigen Antibody, Unconjugated from HyTest Ltd.
Company HyTest Ltd.
Item Rabbit Anti-Bacillus anthracis (Anthrax) Spore Antigen Antibody, Unconjugated
Price 
Description In Western blotting antibodies recognize 94 K protein band, which corresponds to S-layer protein
Info HyTest Ltd.HyTest Ltd.
Intelligate, 6th floor
Joukahaisenkatu 6
20520 Turku
Finland
Customer Service: +358 2 5120908
Fax Number: +358 2 5120909
Web Site: http://www.hytest.fi
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Rabbit Anti-Aph-1aL, S Loop (92-115) Polyclonal Antibody, Unconjugated from Covance Research Products, Inc
2. Rabbit Anti-Human Vitamin K-dependent Protein S (PROS1) Polyclonal Antibody, Unconjugated from Lifespan Biosciences
3. Rabbit Anti-Human Sirtuin (silent mating type information regulation 2, S.cerevisiae, homolog) 7 (SIRT7) Polyclonal Antibody, Unconjugated from Lifespan Biosciences
4. Rabbit Anti-Esa1 Polyclonal Antibody, Unconjugated from Abcam
5. Rabbit Anti-Human Rad51 Polyclonal Antibody, Unconjugated from Abcam
6. Human CALCA EIA (Enzyme immunoassay) Kit, Host: Rabbit ; Extraction-free from BACHEM
7. MaxArray Tissue Array (Animal - Rabbit) from Invitrogen
8. Rabbit Anti-GST Polyclonal Antibody, Unconjugated from Novus Biologicals
9. Rabbit Anti-Shigella Polyclonal Antibody, Unconjugated from GeneTex
10. Vaginal Keratinocyte Progenitors, Rabbit from CHEMICON
11. Dermal Fibroblasts, Rabbit from CHEMICON
Mouse monoclonal antibody raised against a full length recombinant SNAPC5. NCBI Entrez Gene ID = SNAPC5...
Agarose II (Low Melt)...
... monoclonal antibody raised against a partial recombinant NFKBIB. ... a.a. ~ 145 a.a) partial recombinant protein with ... EDGDTALHLAVIHQHEPFLDFLLGFSAGTEYMDLQNDLGQTALHLAAILGETSTVEKLYAAGAGLCVAERRGHTALHLACRVGAHACARA Accession: BC015528 ... OMIM: 604495, ...
Mouse monoclonal antibody raised against a partial recombinant CRKRS. NCBI Entrez Gene ID = CRKRS...
Biology Products:
(Date:5/6/2017)... , May 5, 2017 RAM ... announced a new breakthrough in biometric authentication based ... quantum mechanical properties to perform biometric authentication. These new ... semiconductor material created by Ram Group and its ... entertainment, transportation, supply chains and security. Ram Group ...
(Date:4/19/2017)... April 19, 2017 The global ... landscape is marked by the presence of several large ... held by five major players - 3M Cogent, NEC ... accounted for nearly 61% of the global military biometric ... in the global military biometrics market boast global presence, ...
(Date:4/17/2017)... Florida , April 17, 2017 NXT-ID, ... technology company, announces the filing of its 2016 Annual Report on ... and Exchange Commission. ... on Form 10-K is available in the Investor Relations section of ... as on the SEC,s website at http://www.sec.gov . ...
Breaking Biology News(10 mins):
(Date:10/11/2017)... (PRWEB) , ... October 11, 2017 , ... ComplianceOnline’s Medical ... place on 7th and 8th June 2018 in San Francisco, CA. The Summit brings ... well as several distinguished CEOs, board directors and government officials from around the world ...
(Date:10/11/2017)... the Netherlands and LAGUNA HILLS, Calif. ... The Institute of Cancer Research, London ... use MMprofiler™ with SKY92, SkylineDx,s prognostic tool to risk-stratify patients ... trial known as MUK nine . The University of ... trial, which is partly funded by Myeloma UK, and ICR ...
(Date:10/11/2017)... , ... October 11, 2017 , ... ... (FDA) has granted orphan drug designation to SBT-100, its novel anti-STAT3 (Signal Transducer ... treatment of osteosarcoma. SBT-100 is able to cross the cell membrane and bind ...
(Date:10/10/2017)... ... October 10, 2017 , ... For ... has won a US2020 STEM Mentoring Award. Representatives of the FirstHand program travelled ... Volunteer Experience from US2020. , US2020’s mission is to change the trajectory of ...
Breaking Biology Technology: