Navigation Links
Rabbit Anti-NMDA NR2B, phospho (Tyr1336) Polyclonal Antibody, Unconjugated from Novus Biologicals

ProductsRabbit Anti-NMDA NR2B, phospho (Tyr1336) Polyclonal Antibody, Unconjugated from Novus Biologicals
Company Novus Biologicals
Item Rabbit Anti-NMDA NR2B, phospho (Tyr1336) Polyclonal Antibody, Unconjugated
Price $295.00
Description Rabbit polyclonal antibody to NMDA NR2B [Tyr1336]
Info Novus BiologicalsNovus Biologicals
8100 Southpark Way
Unit A-8
Littleton, CO 80120
Customer Service: (888) 506-6887
Tech Support: (303) 730-1950
Fax Number: (303) 730-1966
Web Site: http://www.novusbio.com
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Rabbit Anti-Aph-1aL, S Loop (92-115) Polyclonal Antibody, Unconjugated from Covance Research Products, Inc
2. Rabbit Anti-Human Vitamin K-dependent Protein S (PROS1) Polyclonal Antibody, Unconjugated from Lifespan Biosciences
3. Rabbit Anti-Human Sirtuin (silent mating type information regulation 2, S.cerevisiae, homolog) 7 (SIRT7) Polyclonal Antibody, Unconjugated from Lifespan Biosciences
4. Rabbit Anti-Esa1 Polyclonal Antibody, Unconjugated from Abcam
5. Rabbit Anti-Human Rad51 Polyclonal Antibody, Unconjugated from Abcam
6. Human CALCA EIA (Enzyme immunoassay) Kit, Host: Rabbit ; Extraction-free from BACHEM
7. MaxArray Tissue Array (Animal - Rabbit) from Invitrogen
8. Rabbit Anti-GST Polyclonal Antibody, Unconjugated from Novus Biologicals
9. Rabbit Anti-Shigella Polyclonal Antibody, Unconjugated from GeneTex
10. Vaginal Keratinocyte Progenitors, Rabbit from CHEMICON
11. Dermal Fibroblasts, Rabbit from CHEMICON
... proteins in polyacrylamide gel after SDS ... ng of protein) with *CoomassieR-G250. All ... can be performed in 1.5 hr. ... proteins can be seen before destaining. ...
Mouse monoclonal antibody raised against a partial recombinant PASK. NCBI Entrez Gene ID = PASK...
Mouse monoclonal antibody raised against a partial recombinant CRKRS. NCBI Entrez Gene ID = CRKRS...
... raised against a partial recombinant FES. ... a.a. ~ 250 a.a) partial recombinant protein ... Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA Accession: ... Number: AAH35357 OMIM: ...
Biology Products:
(Date:3/30/2017)... ANGELES , March 30, 2017  On April ... Hack the Genome hackathon at Microsoft,s ... exciting two-day competition will focus on developing health and ... Hack the Genome is the ... been tremendous. The world,s largest companies in the genomics, ...
(Date:3/28/2017)... India , March 28, 2017 ... IP, Biometrics), Hardware (Camera, Monitors, Servers, Storage Devices), Software ... Vertical, and Region - Global Forecast to 2022", published ... Billion in 2016 and is projected to reach USD ... between 2017 and 2022. The base year considered for ...
(Date:3/23/2017)... The report "Gesture Recognition and Touchless Sensing Market by ... Global Forecast to 2022", published by MarketsandMarkets, the market is expected to be ... 2017 and 2022. Continue Reading ... ... ...
Breaking Biology News(10 mins):
(Date:10/12/2017)... , ... October 12, 2017 , ... ... Vilnius, Lithuania, announced today that they have entered into a multiyear collaboration to ... provide CRISPR researchers with additional tools for gene editing across all applications. , ...
(Date:10/12/2017)... ... 12, 2017 , ... AMRI, a global contract research, development ... patient outcomes and quality of life, will now be offering its impurity solutions ... new regulatory requirements for all new drug products, including the finalization of ICH ...
(Date:10/11/2017)... ... October 11, 2017 , ... The CRISPR-Cas9 system ... experiments and avoiding the use of exogenous expression plasmids. The simplicity of programming ... systematic gain-of-function studies. , This complement to loss-of-function studies, such as with ...
(Date:10/11/2017)... , ... October 11, 2017 , ... ... announced today it will be hosting a Webinar titled, “Pathology is going digital. ... Associates , on digital pathology adoption best practices and how Proscia improves lab ...
Breaking Biology Technology: