Navigation Links
RQ1 RNase-Free DNase from Promega

ProductsRQ1 RNase-Free DNase from Promega
Company Promega
Item RQ1 RNase-Free DNase
Price $36.00
Description RQ1 RNase-Free DNase is a preparation of deoxyribonuclease I that degrades single-stranded or double-stranded DNA to produce 3-hydroxyl oligonucleotides. This preparation is qualified for use in applications where maintaining the integrity of RNA is critical. RQ1 DNase is qualified for use with the Core Footprinting System (Cat.# E3730).
Info PromegaPromega
2800 Woods Hollow Rd.
Madison, WI 53711-5399 USA
Customer Service: 800-356-9526
Tech Support: 1-800-356-9526
Fax Number: 800-356-1970
Web Site: http://www.promega.com
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. RNase-Free Dnase from BD Biosciences Pharmingen
2. UltraPure DNase/RNase-Free Distilled Water from Invitrogen
3. UltraPure DNase/RNase-Free Distilled Water from Invitrogen
4. DNase I (RNase-free) (2 U/l) from Ambion
5. TURBO DNase (2 U/l) from Ambion
6. DNase I, RNase-free; special quality for molecular biology from Roche Applied Science
7. DNase I from Invitrogen
8. DNase I, ds Qualified from Novagen
9. DNase I Amplification Grade from Invitrogen
10. RNase, DNase-free from Roche Applied Science
11. Rabbit Anti-Human DNase II Polyclonal Antibody, Unconjugated from Calbiochem
... Mouse monoclonal antibody raised ... Immunogen: ... 206 a.a) partial recombinant protein ... Accession Number: NM_005802 ...
Mouse monoclonal antibody raised against a full length recombinant SNAPC5. NCBI Entrez Gene ID = SNAPC5...
... monoclonal antibody raised against a partial recombinant NFKBIB. ... a.a. ~ 145 a.a) partial recombinant protein with ... EDGDTALHLAVIHQHEPFLDFLLGFSAGTEYMDLQNDLGQTALHLAAILGETSTVEKLYAAGAGLCVAERRGHTALHLACRVGAHACARA Accession: BC015528 ... OMIM: 604495, ...
... Perm/Wash Buffer I can be used in ... to permeabilize cells and to serve as ... Because saponin-mediated cell permeabilization is a reversible ... cells in the presence of saponin during ...
Biology Products:
(Date:5/23/2017)...  Hunova, the first robotic gym for the rehabilitation and functional motor ... Genoa, Italy . The first 30 robots will be ... USA . The technology was developed and patented at the ... spin-off Movendo Technology thanks to a 10 million euro investment from entrepreneur ... ...
(Date:4/19/2017)... 2017 The global military biometrics ... marked by the presence of several large global players. ... five major players - 3M Cogent, NEC Corporation, M2SYS ... nearly 61% of the global military biometric market in ... global military biometrics market boast global presence, which has ...
(Date:4/11/2017)... April 11, 2017 Crossmatch®, a globally-recognized ... solutions, today announced that it has been awarded ... Projects Activity (IARPA) to develop next-generation Presentation Attack ... "Innovation has been a driving force within ... will allow us to innovate and develop new ...
Breaking Biology News(10 mins):
(Date:8/11/2017)... ... ... Algenist continues to disrupt the skincare industry with today’s debut of GENIUS Liquid ... the key structural element skin needs to maintain its youthful appearance and Algenist is ... First to market with proprietary collagen water active , Active ...
(Date:8/10/2017)... ... August 09, 2017 , ... Teachers from three Philadelphia middle ... 14th through the 16th, the University City Science Center will kick off the ... provides Philadelphia-based middle school educators an opportunity for professional development related to STEM ...
(Date:8/10/2017)... ... August 09, 2017 , ... Okyanos Center for Regenerative Medicine has announced its ... Hotel in Freeport, Grand Bahama on September 27, 2017. This daytime event is free ... from the Ministry of Health’s National Stem Cell Ethics Committee (NSCEC) and regulations laid ...
(Date:8/10/2017)... USA, and CARDIFF, UK (PRWEB) , ... August ... ... and photonics, has announced an agreement establishing Kinokuniya Company Ltd. as its exclusive ... SPIE as the exclusive sales representative for the SPIE Digital Library in Japan. ...
Breaking Biology Technology: