Navigation Links
ProteomeLab PA 800 Protein Characterization System from Beckman Coulter

ProductsProteomeLab PA 800 Protein Characterization System from Beckman Coulter
Company Beckman Coulter
Item ProteomeLab PA 800 Protein Characterization System
Price 
Description The ProteomeLab PA 800 is an automated, high-resolution protein analysis system. Part of Beckman Coulters ProteomeLab family of products, the PA 800 offers a comprehensive range of automated protein characterization solutions including molecular weight determination, peptide mapping, isoelectric focusing, carbohydrate profiling and mechanisms to study protein/protein interactions in solution. Based on Beckman Coulters well-established automation and capillary electrophoresis technologies, the PA 800 addresses important issues in the characterization of a given proteome manipulating and resolving low levels of proteins that range from acidic to basic to membrane-bound.
Info Beckman CoulterBeckman Coulter
4300 N. Harbor Boulevard
PO Box 3100
Fullerton, CA 92834-3100
U.S.A.
Customer Service: (800) 742-2345
Fax Number: (800) 643-4366
Web Site: http://www.beckmancoulter.com
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. ProteomeLab PF 2D Protein Fractionation System from Beckman Coulter
2. Mouse Anti-Protein S Monoclonal Antibody, Unconjugated, Clone HYB 232-02 from Abcam
3. S-Protein Agarose from Novagen
4. Rabbit Anti-Human Vitamin K-dependent Protein S (PROS1) Polyclonal Antibody, Unconjugated from Lifespan Biosciences
5. S-Protein Agarose from Novagen
6. S-Protein Agarose from Novagen
7. Standard Protein Kinase Substrate (PKS) Peptide Microarray from LC Sciences
8. Protein 295 ex from HORIBA Jobin Yvon
9. Protein Kinase Substrate (PKS) Peptide Microarray - Comprehensive Service from LC Sciences
10. Imaging Mass Spectrometry for Small Molecule Localization from Protein Discovery, Inc.
11. ProteinPilot Software from Applied Biosystems
... a partial recombinant FES. ... 250 a.a) partial recombinant protein with GST ... WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA Accession: BC035357 ... AAH35357 OMIM: 190030, ...
Mouse monoclonal antibody raised against a partial recombinant PRKG1. NCBI Entrez Gene ID = PRKG1...
... raised against a partial recombinant ... PPP4C (NP_002711, 218 a.a. ... protein with GST tag. ... NM_002720 Protein ...
Mouse monoclonal antibody raised against a full length recombinant GPT. NCBI Entrez Gene ID = GPT...
Biology Products:
(Date:6/3/2016)... 3, 2016 Das ... Nepal hat ein 44 ... geprägter Kennzeichen, einschließlich Personalisierung, Registrierung und IT-Infrastruktur, ... Produktion und Implementierung von Identitätsmanagementlösungen. Zahlreiche renommierte ... Januar teilgenommen, aber Decatur wurde als konformste ...
(Date:6/2/2016)... June 2, 2016   The Weather Company , an ... Ads, an industry-first capability in which consumers will be able ... to ask questions via voice or text and receive relevant ... Marketers have long sought an advertising solution ... can be personal, relevant and valuable; and can scale across ...
(Date:6/1/2016)... Favorable Government Initiatives Coupled With ... Identification to Boost Global Biometrics System Market Through 2021  ... report, " Global Biometrics Market By Type, By ... 2011 - 2021", the global biometrics market is projected ... of growing security concerns across various end use sectors ...
Breaking Biology News(10 mins):
(Date:6/23/2016)... ... June 23, 2016 , ... Charm ... Mold) microbial test has received AOAC Research Institute approval 061601. , “This is ... last year,” stated Bob Salter, Vice President of Regulatory and Industrial Affairs. “The ...
(Date:6/23/2016)... ... June 23, 2016 , ... Supplyframe, the ... the Supplyframe Design Lab . Located in Pasadena, Calif., the Design Lab’s ... how hardware projects are designed, built and brought to market. , The Design ...
(Date:6/23/2016)... NEWPORT BEACH, Calif. , June 23, 2016 /PRNewswire/ ... offering new biological discoveries to the medical community, has ... and co-founder Matthew Nunez . "We ... provide us with the capital we need to meet ... funding will essentially provide us the runway to complete ...
(Date:6/23/2016)... Pleasant Prairie, WI (PRWEB) , ... June 23, ... ... sciences consultancy focused on quality, regulatory and technical consulting, provides a free ... webinar is presented on July 13, 2016 at 12pm CT at no charge. ...
Breaking Biology Technology: