Navigation Links
Protein Kinase Substrate (PKS) Peptide Microarray - Comprehensive Service from LC Sciences

ProductsProtein Kinase Substrate (PKS) Peptide Microarray - Comprehensive Service from LC Sciences
Company LC Sciences
Item Protein Kinase Substrate (PKS) Peptide Microarray - Comprehensive Service
Price 
Description LC Sciences provides a comprehensive kinase analysis service utilizing high density protein kinase substrate (PKS) peptide microarrays synthesized on Paraflo microfluidic chips for proteomic scale kinase profiling, quantitative measurement of kinase kinetic activities, and drug discovery research. This comprehensive service includes preparation of your kinase sample, single or dual color enzymatic reactions, array scanning and data analysis. Two-three weeks after receiving your kinase sample(s), we send you a data summary report containing background subtraction, control and reference signal guided data processing, list of detected signals, and data averaging. We offer additional services for in-depth kinetic data analysis and curve analysis of quantitative measurements.

Our standard content PKS peptide microarray includes a comprehensive list of kinases and their related experimentally verified Serine, Threonine, and Tyrosine phosphorylation sites compiled from the Phospho.ELM database. Customization of standard arrays is permitted and you can specify up to 20 additional peptide sequences for up to 5 additional kinases at no extra cost, or choose a completely custom microarray. Thousands of customer specified substrate sequences can be synthesized on-chip and LC Sciences can provide assistance with custom sequence design.

Well designed positive and negative controls as well as a universal highly phosphate-specific fluorescent dye staining reagent ensure quantitative results. There is no need for radioisotope labeling and potential signal bias due to antibody sequence specificity is eliminated. Test sequence signals can be directly compared to phosphopeptide signals (considered to be 100% of phosphorylation reading).

LC Sciences
LC Sciences is a genomics and proteomics company offering innovative, customizable, and comprehensive microarray services for nucleic acid/protein profiling and functional analysis, biomarker-discovery, novel drug screening, and the custom development of diagnostic devices. We provide unique one-stop products and services for assays of DNA, RNA, protein, enzymes, antibodies, or small molecules, as well as proven microfluidic technology and novel microarray chemistry for design of your miniaturized assay devices for diagnostics and biosensing applications.

Our microarray services include the use of custom synthesized microarrays based on the Paraflo on-chip synthesis technology which enables the total customization of content on each individual microarray. Our customers have the flexibility to use our standard probe content or their own custom designed probe content and to use probes of their chosen lengths and number of replicates. The Paraflo technology also provides the flexibility of synthesizing microarrays containing probes with modifications such as, 5-amino linker, phosphate, biotin, and various methylation or other types of modifications. Incorporation of modifications greatly increases the number of applications for these microarrays.

LC Sciences offers additional Paraflo technology derived products that serve customers needs for construction of biomolecular libraries containing up to millions of different biomolecules of defined sequences. These products significantly reduce the cost and increase the speed of highly multiplexing genome-scale experiments such as exploration of small RNAs and designer gene/DNA library synthesis.
Info LC SciencesLC Sciences
2575 W. Bellfort
Suite 270
Houston, TX 77054

Call LC Sciences to buy products (US and Canada only; other locations use numbers below)
USA Canada 1-713-574-7399
Customer Service: (713) 664-7087 or Toll Free: (888) 528-8818
Fax Number: (713) 664-8181
Web Site: http://www.lcsciences.com
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Mouse Anti-Protein S Monoclonal Antibody, Unconjugated, Clone HYB 232-02 from Abcam
2. S-Protein Agarose from Novagen
3. Rabbit Anti-Human Vitamin K-dependent Protein S (PROS1) Polyclonal Antibody, Unconjugated from Lifespan Biosciences
4. S-Protein Agarose from Novagen
5. S-Protein Agarose from Novagen
6. Standard Protein Kinase Substrate (PKS) Peptide Microarray from LC Sciences
7. Protein 295 ex from HORIBA Jobin Yvon
8. ProteomeLab PA 800 Protein Characterization System from Beckman Coulter
9. ProteomeLab PF 2D Protein Fractionation System from Beckman Coulter
10. Imaging Mass Spectrometry for Small Molecule Localization from Protein Discovery, Inc.
11. ProteinPilot Software from Applied Biosystems
Mouse monoclonal antibody raised against a full length recombinant CSNK2A2. NCBI Entrez Gene ID = CSNK2A2...
... DNA Visualizer Extraction Kit is manufactured ... causing DNA damage byexposure to UV light. ... gel is often used for DNA-cloning work. ... ethidium bromide and exposure of UV light ...
... Mouse monoclonal antibody raised against a partial ... (AAH39825, 358 a.a. ~ 457 a.a) partial recombinant ... Sequence: PPKQQSQEKPPQTLFPSIVKNMPTKPNGTLSHKSGRRRWGQTIFKSGDSWEELEDYDFGASHSKKPSMGVFKEKRKKDSPFRQQVKMAVISLSAHQFPTL Accession: ... AAH39825 OMIM: 154235, ...
Mouse monoclonal antibody raised against a partial recombinant L3MBTL2. NCBI Entrez Gene ID = L3MBTL2...
Biology Products:
(Date:4/17/2014)... NJ. April 16, 2014. Kessler Foundation has been ... million from the Department of Defense Spinal Cord ... principal investigator for the randomized, double-blinded, controlled, multi-site ... bone and muscle strength after spinal cord injury. ... & Engineering Research at Kessler Foundation. Two additional ...
(Date:4/17/2014)... births, Down syndrome - or trisomy 21 - is ... results from a chromosomal abnormality where cells of affected ... of the human genome). A study conducted by Stylianos ... Medicine and Development at the University of Geneva (UNIGE) ... light on how the extra chromosome 21 upsets the ...
(Date:4/17/2014)... ago, Katia Silvera , a postdoctoral scholar at the ... field trip in a mountainous area in central Panama when ... , Unable to identify it, they contacted German Carnevali, a ... be an unnamed species. So Carnevali recently named it after ... genus name, comprising about 40 species in the world. ...
Breaking Biology News(10 mins):Kessler Foundation awarded Department of Defense grant for spinal cord injury research 2Trisomy 21: How an extra little chromosome throws the entire genome off balance 2Trisomy 21: How an extra little chromosome throws the entire genome off balance 3Orchid named after UC Riverside researcher 2Orchid named after UC Riverside researcher 3
... 2013) The Algae Biomass Organization (ABO), the trade ... of "Industrial Algae Measurements, Version 6.0" (IAM 6.0), ... by the organization for measuring and comparing algae ... new technologies to create fuels, feeds, nutritional supplements, ...
... this Moderate Resolution Imaging Spectroradiometer (MODIS) satellite image collected on ... Terra satellite and actively burning areas, detected by MODIS,s thermal ... is banned in Indonesia, but that does not always stop ... unusual dry spell in the area (this is usually the ...
... influence actual heart health, according to new research. A study ... ways in which your spouse is supportive and how ... on your overall cardiovascular health. The findings reveal that ... other as ambivalent that is, sometimes helpful and sometimes ...
Cached Biology News:ABO updates standards for measuring algae industry operations 2ABO updates standards for measuring algae industry operations 3ABO updates standards for measuring algae industry operations 4Heart disease risk linked with spouses' social support 2
(Date:1/15/2014)... DTS Language Services, Inc . is ... for Life Science organizations who need document translations. Clients ... of their documents in advance with a selection of nearly ... translations, often a critical factor in clinical and scientific fields, ...
(Date:1/14/2014)... Doylestown, PA (PRWEB) January 14, 2014 Date: ... p.m. , Location: Warrington Country Club, 1360 Almshouse Road, Warrington, ... only national nonprofit organization solely dedicated to finding a cure ... those affected worldwide, will host its annual Crystal Ball on ...
(Date:1/14/2014)... (PRWEB) January 14, 2014 EquitiesIQ, a ... Inc. (OTCQB: ALQA). Alliqua is an emerging biomedical company ... the wound care market. , Free report download: ... with a seasoned management team and Board, which launched ...
(Date:1/14/2014)... Jan. 14, 2014  RXi Pharmaceuticals Corporation (OTCQX: RXII), ... commercializing innovative therapies addressing major unmet medical needs ... the Notice of Allowance from the United States ... RNAi compounds (sd-rxRNA®), for the treatment of fibrosis. ...
Breaking Biology Technology:DTS Improves Efficiency for Life Science Document Translations 2Hepatitis B Foundation to Host Annual Crystal Ball Gala 2EquitiesIQ Initiates Coverage of Alliqua, Inc. 2EquitiesIQ Initiates Coverage of Alliqua, Inc. 3RXi Pharmaceuticals Receives US Notice of Allowance for a Key Patent Relating to its Self-Delivering Technology with sd-rxRNAs targeting CTGF, including RXI-109, for the Treatment of Fibrotic Disorders 2RXi Pharmaceuticals Receives US Notice of Allowance for a Key Patent Relating to its Self-Delivering Technology with sd-rxRNAs targeting CTGF, including RXI-109, for the Treatment of Fibrotic Disorders 3