Navigation Links
Precision XS Microplate Sample Processor from BioTek Instruments

ProductsPrecision XS Microplate Sample Processor from BioTek Instruments
Company BioTek Instruments
Item Precision XS Microplate Sample Processor
Price 
Description The Precision XS uniquely combines a single-channel sample processing head, an 8-channel pipetting head and an 8-channel bulk reagent dispenser all in one compact, affordable product. In addition to transfers using disposable pipette tips, the Precision XS autoclavable and organic solvent resistant bulk reagent dispenser is available for transferring larger volumes. Intuitive Precision Power PC software simplifies the programming of applications from hit picking to serial dilutions even for those new to automated liquid handling. BioTeks Bio-Stack microplate stacker increases liquid handling throughput by delivering up to 30 microplates to the Precision XS platform.

The Precision XS is the best solution in sample processors for todays modern lab providing the power of unattended operation over manual pipetting with the simplicity and economy lacking in high-end liquid handlers. The Precision XS is specifically designed to fit into most biological safety cabinets and chemical fume hoods.

Info BioTek InstrumentsBioTek Instruments
P.O. Box 998
Winooski, Vermont 05404
USA

Call BioTek Instruments to buy products (US and Canada only; other locations use numbers below)
USA Canada 1-866-545-6854
Customer Service: (800) 451-5172
Fax Number: (802) 655-7941
Web Site: http://www.biotek.com/
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. PB3002-S/FACT DeltaRange Precision Balance from Mettler Toledo, Inc.
2. PL1501-S Precision Balance from Mettler Toledo, Inc.
3. LX80 Series Precision Stages from Parker Hannifin Corporation
4. MX80 Series Miniature Precision Stages from Parker Hannifin Corporation
5. XRS Series Precision Linear Tables from Parker Hannifin Corporation
6. Multi-OSMETTE from Precision Systems, Inc.
7. Micro-OSMETTE from Precision Systems, Inc.
8. WR CRYETTE from Precision Systems, Inc.
9. ANALETTE II from Precision Systems, Inc.
10. OSMETTE XL from Precision Systems, Inc.
11. OSMETTE III from Precision Systems, Inc.
... antibody raised against a partial recombinant FES. ... 120 a.a. ~ 250 a.a) partial recombinant ... Protein Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA ... Accession Number: AAH35357 ...
... Mouse polyclonal antibody raised against ... Immunogen: PPP4C ... a.a) partial recombinant protein with ... Accession Number: NM_002720 ...
Mouse monoclonal antibody raised against a partial recombinant CAPG. NCBI Entrez Gene ID = CAPG...
...
Biology Products:
(Date:4/28/2016)... , April 28, 2016 First quarter ... (139.9), up 966% compared with the first quarter of 2015 ... totaled SEK 589.1 M (loss: 18.8) and the operating margin was ... (loss: 0.32) Cash flow from operations was SEK 249.9 ... 2016 revenue guidance is unchanged, SEK 7,000-8,500 M. The ...
(Date:4/19/2016)... , UAE, April 20, 2016 ... implemented as a compact web-based "all-in-one" system solution for ... biometric fingerprint reader or the door interface with integration ... modern access control systems. The minimal dimensions of the ... readers into the building installations offer considerable freedom of ...
(Date:4/14/2016)... , April 14, 2016 ... Malware Detection, today announced the appointment of Eyal ... new role. Goldwerger,s leadership appointment comes at ... heels of the deployment of its platform at several ... biometric technology, which discerns unique cognitive and physiological factors, ...
Breaking Biology News(10 mins):
(Date:6/27/2016)... ... June 27, 2016 , ... Rolf K. Hoffmann, former ... of the University of North Carolina Kenan-Flagler Business School effective June ... UNC Kenan-Flagler, with a focus on the school’s international efforts, leading classes and ...
(Date:6/24/2016)... Brooklyn, NY (PRWEB) , ... June 24, 2016 , ... ... 15mm, machines such as the Cary 5000 and the 6000i models are higher end ... height is the height of the spectrophotometer’s light beam from the bottom of the ...
(Date:6/23/2016)... 2016 /PRNewswire/ - FACIT has announced the creation ... biotechnology company, Propellon Therapeutics Inc. ("Propellon" or "the ... a portfolio of first-in-class WDR5 inhibitors for the ... WDR5 represent an exciting class of therapies, possessing ... for cancer patients. Substantial advances have been achieved ...
(Date:6/23/2016)... , June, 23, 2016  The Biodesign Challenge (BDC), ... new ways to harness living systems and biotechnology, announced ... (MoMA) in New York City . ... participating students, showcased projects at MoMA,s Celeste Bartos Theater ... Antonelli , MoMA,s senior curator of architecture and design, ...
Breaking Biology Technology: