Navigation Links
PicTure - Double Staining Kit from Invitrogen

ProductsPicTure - Double Staining Kit from Invitrogen
Company Invitrogen
Item PicTure - Double Staining Kit
Price 
Description Double staining is a technique used to reveal two distinct antigens in a single tissue.(1-6) PicTure™-Double Staining Kit is a Zymed polymer double staining detection method for detecting two antigens simultaneously in the same human cell or tissue sample with increased sensitivity. The antigens can be identified using two different primary antibodies from mouse (or rat) and rabbit (or guinea pig) species. Zymeds PicTure™-Double Staining kit allows the mouse (or rat) and rabbit (or guinea pig) primary antibodies to be applied simultaneously on tissue specimens.PicTure™-Double Staining contains two enzyme polymer conjugates: Gt anti-Mouse IgG-HRP & Gt anti-Rabbit IgG-AP polymer conjugates. Both enzyme polymer conjugates can be applied on the specimen at the same time. This simultaneous double staining method is faster and easier than a sequential method. The polymer conjugate contains multiple enzymes and Fab fragments of second antibodies to provide excellent sensitivity. In addition, PicTure™-Double Staining does not contain biotin or streptavidin and uses only Fab fragments, so potential background due to endogenous biotin activity or Fc receptors is completely avoided.PicTure™-Double Staining kit utilizes two distinct substrate/chromogen/enzyme systems. Goat anti-Mouse IgG-HRP is used with DAB to produce one stain (brown); Goat anti-Rabbit IgG-AP is used with Fast-Red to produce a second stain (red).
Info InvitrogenInvitrogen
Invitrogen Corporation
1600 Faraday Ave.
Carlsbad, CA 92008

Call Invitrogen to buy products (US and Canada only; other locations use numbers below)
USA Canada 1-866-521-4270
Customer Service: 800-955-6288
Tech Support: 800-955-6288 ext. 2
Fax Number: 760-603-7229
Web Site: http://www.invitrogen.com
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Double labelled probes from Thermo Scientific
3. 2 Doublestain System, Rabbit/Mouse (DAB+/Permanent Red) from Dako
4. 55D Double Platform Shaker 12 x 16 from Reliable Scientific
5. Isolated Mitochondria Staining Kit from Sigma-Aldrich
6. Anti-Rat HRP-AEC Cell & Tissue Staining Kit from R&D Systems
7. Anti-Rat HRP-DAB Cell & Tissue Staining Kit from R&D Systems
8. Criterion Staining and Blotting Trays, with lids, 12 from Bio-Rad
9. Gram Staining Kit from Sigma-Aldrich
10. Large Disposable Staining Trays. from PGC Scientifics
11. Protein Staining Solution from Abnova Corporation
12. Propidium Iodide Staining Solution Solution from BD Biosciences Pharmingen
... polyclonal antibody raised against a partial recombinant ... (AAH35357, 120 a.a. ~ 250 a.a) partial ... Protein Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA ... Protein Accession Number: AAH35357 ...
Mouse monoclonal antibody raised against a partial recombinant PRKG1. NCBI Entrez Gene ID = PRKG1...
... polyclonal antibody raised against a ... Immunogen: PPP4C (NP_002711, ... partial recombinant protein with GST ... Number: NM_002720 ...
Mouse monoclonal antibody raised against a full length recombinant GPT. NCBI Entrez Gene ID = GPT...
Biology Products:
(Date:7/22/2020)... ... 21, 2020 , ... USDM Life Sciences , a ... a new solution to manage regulated workloads on Microsoft Azure. , Regulated biotechnology, ... complies with FDA and global regulations. USDM's new managed service for regulated workloads ...
(Date:7/4/2020)... ... July 03, 2020 , ... Aesthetics Biomedical ... and multiple awards for not only the products and treatments developed, but also ... Vivace® Microneedle RF. All the brands built by ABM have received several honors ...
(Date:6/28/2020)... ... June 25, 2020 , ... ... biopharmaceutical R&D, today announced that it has entered into a multi-year contract ... (Multiclonics®), to support their translational and clinical research strategy to discover and ...
Breaking Biology News(10 mins):
(Date:9/1/2020)... ... September 01, 2020 , ... ... diagnostics companies, has announced the placement of Julianne Averill , CPA, as ... leading all financial operations and implementing key business strategies to accelerate Alveo’s growth ...
(Date:8/15/2020)... SCOTTSDALE, Ariz. (PRWEB) , ... August 13, 2020 ... ... 4254 on its annual Inc. 5000 list, the most prestigious ranking of the ... successful companies within the American economy’s most dynamic segment—its independent small businesses. Intuit, ...
(Date:8/12/2020)... ... August 12, 2020 , ... Inc. ... a global leader in FDA compliance consulting has been named on its annual ... The list represents a unique look at the most successful companies within the ...
(Date:8/3/2020)... ... ... Introducing Ardent Animal Health – MediVet Biologics rebrands company and positions its platform ... Biologics since its formation in 2016, the company is relaunching itself under the Ardent ... its base of innovative therapies for osteoarthritis and cancer. , ...
Breaking Biology Technology: