Navigation Links
Peptide Design and Custom Synthesis from Global Peptide Services, LLC.

ProductsPeptide Design and Custom Synthesis from Global Peptide Services, LLC.
Company Global Peptide Services, LLC.
Item Peptide Design and Custom Synthesis
Price 
Description Best pricing for 100mg-1.0g scales. Phosphopeptides are our specialty.
Info Global Peptide Services, LLC.Global Peptide Services, LLC.
1414 Blue Spruce, Unit F
Ft. Collins, Co 80524
Customer Service:
(800) 886-1895
(970) 494-4483
Fax Number:
(800) 956-3884
970-494-4485
Web Site: https://www.globalpeptide.com
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Standard Protein Kinase Substrate (PKS) Peptide Microarray from LC Sciences
2. Protein Kinase Substrate (PKS) Peptide Microarray - Comprehensive Service from LC Sciences
3. Human and Mouse RAR Neutralizing Peptide from ABR-Affinity BioReagents
4. Epitope Peptide Microarray - Comprehensive Service from LC Sciences
5. Custom Peptide Microarray - Comprehensive Service from LC Sciences
6. Peptide Synthesis from Sigma-Genosys
7. Rat rab 3D Neutralizing Peptide from ABR-Affinity BioReagents
8. Rat SAP97 Neutralizing Peptide from ABR-Affinity BioReagents
9. Rat SCAMP 5 Neutralizing Peptide from ABR-Affinity BioReagents
10. Ph.D. Peptide Display Cloning System from New England Biolabs
11. Bovine rhodopsin Neutralizing Peptide from ABR-Affinity BioReagents
... Mouse monoclonal antibody raised against a partial recombinant ... 56 a.a. ~ 145 a.a) partial recombinant protein ... EDGDTALHLAVIHQHEPFLDFLLGFSAGTEYMDLQNDLGQTALHLAAILGETSTVEKLYAAGAGLCVAERRGHTALHLACRVGAHACARA Accession: BC015528 ... OMIM: 604495, ...
... The BD PhosFlow Perm/Wash Buffer I can ... modified signaling proteins to permeabilize cells and ... cell wash buffer. Because saponin-mediated cell permeabilization ... to keep the cells in the presence ...
Mouse monoclonal antibody raised against a partial recombinant ACTN4. NCBI Entrez Gene ID = ACTN4...
Rabbit polyclonal antibody to GluR2...
Biology Products:
(Date:8/20/2014)... LAKE CITY Researchers at Huntsman Cancer Institute (HCI) at ... forms of the gene that encodes BCR-ABL, the unregulated ... According to the American Cancer Society, nearly 6,000 new ... Drugs already in use, called tyrosine kinase inhibitors (TKIs), ... They do not cure CML but control it in ...
(Date:8/20/2014)... State University, the Wellcome Trust Sanger Institute and the ... Mycobacterium pinnipedii from skeletons found in Peru ... is a relative of the TB bacterium that affects ... These researchers assume that seals carried the pathogens from ... lions was unexpected" comments Sebastien Gagneux, from the Swiss ...
(Date:8/20/2014)... Bay Area Lyme Foundation, which aims to make Lyme ... new research published in an upcoming issue of the ... . The findings show that ticks that carry ... year, making the threat of Lyme disease year-round. The ... Public Health (CDPH) Vector-borne Disease Section and University of ...
Breaking Biology News(10 mins):Blueprint for next generation of chronic myeloid leukemia treatment 2Lyme disease risk is year-round in Northwest California, according to new study 2Lyme disease risk is year-round in Northwest California, according to new study 3
... Following an agreement between ESA, Krunichev Space Centre and ... and a secondary payload, the technology demonstrator Proba-2 satellite, ... new November launch date follows a rescheduling of the ... Moisture and Ocean Salinity (SMOS) satellite and the secondary ...
... heat shock protein 90 gets steroid receptors into shape ... to targeted therapies for hormone-driven cancers, such as breast ... of Georgia researchers say. "We are trying to ... conformation so they work," says Dr. Ahmed Chadli, biochemist ...
... In the fruit fly,s developing brain, stem cells called ... cell that has a different fate. But neuroblast growth can ... Researchers at Duke-NUS Graduate Medical School in Singapore ... a counterpart in mammals, that can apparently prevent brain tumors ...
Cached Biology News:SMOS and Proba-2 launch rescheduled for November 2Targeting helpers of heat shock proteins could help treat cancer, cardiovascular disease 2Tumor suppressor gene in flies may provide insights for human brain tumors 2
(Date:8/21/2014)... 21, 2014 OTC Markets Group ... a biotechnology company, on its approval to list ... on OTCQX®, the best marketplace for established U.S. ... Logo - http://photos.prnewswire.com/prnh/20110118/MM31963LOGO ... execution of its growth strategy and achievement of ...
(Date:8/21/2014)... Chester, NJ (PRWEB) August 21, 2014 ... of personal selling optimization technology and services for ... publication of “Grading Pharma’s Use of New Commercial ... of Measurement & Analytics. , The article examines ... marketing yield that are being tested in the ...
(Date:8/21/2014)... SoundConnect , a unified communication ... of the nation’s Fastest Growing Private Companies by ... consecutive year. Inc. magazine today ranked SoundConnect NO. ... exclusive ranking of the nation's fastest-growing private companies. ... the most important segment of the economy—America’s independent ...
(Date:8/20/2014)... of patented university inventions licensed to biotechnology firms ... commercialization. To open these roadblocks, the researchers suggest ... the discovery stage could lead to faster commercialization ... derived from discoveries made in university laboratories and ... during clinical trials, which have a high failure ...
Breaking Biology Technology:OTC Markets Group Congratulates Immune Pharmaceuticals on NASDAQ Listing 2Pursuit's Peter Robinson Publishes "Grading Pharma's Use of New Commercial Sales Models" 2SoundConnect Returns on Inc. 5000 List of Fastest Growing Companies 2SoundConnect Returns on Inc. 5000 List of Fastest Growing Companies 3Early bottlenecks in developing biopharmaceutical products delay commercialization 2Early bottlenecks in developing biopharmaceutical products delay commercialization 3