Navigation Links
PR Competitor Assay Green from Invitrogen

ProductsPR Competitor Assay Green from Invitrogen
Company Invitrogen
Item PR Competitor Assay Green
Price 
Description Progesterone Receptor (PR) Competitor Assay Kits are ideal for studying or screening novel progesterone receptor binding compounds using fluorescence polarization (FP) The homogenous assay utilizes a fusion of glutathione transferase to the ligand binding domain of human progesterone receptor [PR-LBD(GST)] and a proprietary, fluorescently-tagged progesterone ligand, Fluormone PL Green or PL Red. Intrinsic background fluorescence from library compounds is substantially reduced utilizing the red-shifted Fluormone ligand.


To assay: PR added to Fluormone L Green or PL Red complexes and has a high polarization value. Test compounds that compete for binding to PR and prevent the formation of a Fluormone/PR complex will result in a lower polarization value. The shift in polarization in the presence of test compounds is used to determine the relative affinity of test compounds for PR.


Contents:
The Progesterone Receptor Competitor Assay Kits contain partially purified PR protein, Fluormone PL Green (green assay kit) or PL Red (red assay kit) proprietary fluorescent progesterone ligands, and buffer.
Info InvitrogenInvitrogen
Invitrogen Corporation
1600 Faraday Ave.
Carlsbad, CA 92008

Call Invitrogen to buy products (US and Canada only; other locations use numbers below)
USA Canada 1-866-521-4270
Customer Service: 800-955-6288
Tech Support: 800-955-6288 ext. 2
Fax Number: 760-603-7229
Web Site: http://www.invitrogen.com
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. PolarScreen Androgen Receptor Competitor Assay Kit, Red from Molecular Probes (Invitrogen)
2. PPARGamma-Competitor Assay Kit Green from Invitrogen
3. PolarScreen Progesterone Receptor Competitor Assay Kit, Far Red from Molecular Probes (Invitrogen)
4. PolarScreen Glucocorticoid Receptor Competitor Assay Kit, Far Red from Molecular Probes (Invitrogen)
5. PolarScreen PPARGamma-Competitor Assay Kit, Red from Molecular Probes (Invitrogen)
6. 5X Competitor II (Mouse) from Takara Mirus Bio
7. Glutathione-S-Transferase (GST) Colorimetric Assay Kit from Sigma-Aldrich
8. In Vitro Osteogenesis Assay Kit from CHEMICON
9. Mast Cell Degranulation colorimetric Assay Kit from CHEMICON
10. Hydrogen Peroxide / Peroxidase Fluorometric (resorufin) Assay Kit, Fluoro H2O2 from BACHEM
11. Total antioxidant capacity Colorimetric Assay Kit from Neogen Corporation
... polyclonal antibody raised against a partial recombinant ... (AAH35357, 120 a.a. ~ 250 a.a) partial ... Protein Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA ... Protein Accession Number: AAH35357 ...
Mouse monoclonal antibody raised against a partial recombinant PRKG1. NCBI Entrez Gene ID = PRKG1...
... polyclonal antibody raised against a ... Immunogen: PPP4C (NP_002711, ... partial recombinant protein with GST ... Number: NM_002720 ...
Mouse monoclonal antibody raised against a full length recombinant GPT. NCBI Entrez Gene ID = GPT...
Biology Products:
(Date:7/22/2020)... ... 21, 2020 , ... USDM Life Sciences , a ... a new solution to manage regulated workloads on Microsoft Azure. , Regulated biotechnology, ... complies with FDA and global regulations. USDM's new managed service for regulated workloads ...
(Date:7/4/2020)... ... July 03, 2020 , ... Aesthetics Biomedical ... and multiple awards for not only the products and treatments developed, but also ... Vivace® Microneedle RF. All the brands built by ABM have received several honors ...
(Date:6/28/2020)... ... June 25, 2020 , ... ... biopharmaceutical R&D, today announced that it has entered into a multi-year contract ... (Multiclonics®), to support their translational and clinical research strategy to discover and ...
Breaking Biology News(10 mins):
(Date:9/1/2020)... ... September 01, 2020 , ... ... diagnostics companies, has announced the placement of Julianne Averill , CPA, as ... leading all financial operations and implementing key business strategies to accelerate Alveo’s growth ...
(Date:8/15/2020)... SCOTTSDALE, Ariz. (PRWEB) , ... August 13, 2020 ... ... 4254 on its annual Inc. 5000 list, the most prestigious ranking of the ... successful companies within the American economy’s most dynamic segment—its independent small businesses. Intuit, ...
(Date:8/12/2020)... ... August 12, 2020 , ... Inc. ... a global leader in FDA compliance consulting has been named on its annual ... The list represents a unique look at the most successful companies within the ...
(Date:8/3/2020)... ... ... Introducing Ardent Animal Health – MediVet Biologics rebrands company and positions its platform ... Biologics since its formation in 2016, the company is relaunching itself under the Ardent ... its base of innovative therapies for osteoarthritis and cancer. , ...
Breaking Biology Technology: