Navigation Links
PCP ELISA Kit, Single from Bio-Quant Inc.

ProductsPCP ELISA Kit, Single from Bio-Quant Inc.
Company Bio-Quant Inc.
Item PCP ELISA Kit, Single
Price $200.00
Description Request Info
Info Bio-Quant Inc.Bio-Quant Inc.
6191 Cornerstone Court East, Suite 101
San Diego, CA 92121
Customer Service: (858) 450-0048
Fax Number: (858) 587-2131
Web Site: http://www.bio-quant.com
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Free Activin A ELISA Kit from Diagnostic Systems Laboratories, Inc.
2. Free Activin AB ELISA Kit from Diagnostic Systems Laboratories, Inc.
3. Free Activin B ELISA Kit from Diagnostic Systems Laboratories, Inc.
4. HIV-1 p24 ELISA Kit, Alliance (480 Tests) from PerkinElmer
5. Porcine Leptin ELISA Kit from Diagnostic Systems Laboratories, Inc.
6. Equine TNF alpha ELISA development Kit, Screening Set from Endogen
7. Staccato Sciclone ELISA Station from Caliper Life Sciences
8. Telomerase ELISA Assay Kit, TRAPEZE from CHEMICON
9. Nuclear Matrix Protein ELISA Kit from Calbiochem
10. Rat TRACP 5b ELISA Kit, TRAPTM from IDS Ltd
11. ELISA Antibody Diluent-Rabbit Polyclonal from AbD Serotec
Agarose II (Low Melt)...
... monoclonal antibody raised against a partial recombinant NFKBIB. ... a.a. ~ 145 a.a) partial recombinant protein with ... EDGDTALHLAVIHQHEPFLDFLLGFSAGTEYMDLQNDLGQTALHLAAILGETSTVEKLYAAGAGLCVAERRGHTALHLACRVGAHACARA Accession: BC015528 ... OMIM: 604495, ...
Mouse monoclonal antibody raised against a partial recombinant CRKRS. NCBI Entrez Gene ID = CRKRS...
... The BD PhosFlow Perm/Wash Buffer I can ... modified signaling proteins to permeabilize cells and ... cell wash buffer. Because saponin-mediated cell permeabilization ... to keep the cells in the presence ...
Biology Products:
(Date:2/16/2017)... 2017  Genos, a community for personal genetic ... received Laboratory Accreditation from the College of American ... laboratories that meet stringent requirements around quality, accuracy ... "Genos is committed to maintaining the ... honored to be receiving CAP accreditation," said ...
(Date:2/10/2017)... , Feb 10, 2017 Research ... report "Personalized Medicine - Scientific and Commercial Aspects" ... ... medicine. Diagnosis is integrated with therapy for selection of treatment ... early detection and prevention of disease in modern medicine. Biochip/microarray ...
(Date:2/8/2017)... Feb. 7, 2017 Report Highlights ... The global synthetic-biology market ... billion by 2021, growing at a compound annual growth rate ... overview of the global markets for synthetic biology. - Analyses ... 2016, and projections of compound annual growth rates (CAGRs) through ...
Breaking Biology News(10 mins):
(Date:2/23/2017)... Maryland (PRWEB) , ... February ... ... PathSensors, Inc., announced today that in a published evaluation of multiple immunoassay-based ... a U.S. Department of Energy Laboratory, PathSensors’ CANARY® biosensor threat detection technology ...
(Date:2/23/2017)... Feb. 23, 2017  Capricor Therapeutics, Inc. (NASDAQ: CAPR), a ... conditions, today announced that Linda Marbán, Ph.D, president and chief ... conferences: Cowen and Company 37th Annual ... ET Boston, MA ... am PT (12:00 pm ET) Dana Point, CA ...
(Date:2/22/2017)... Therapeutics, Inc. (NASDAQ: PETX), a pet therapeutics company focused on ... companion animals, will host a live conference call on Tuesday, ... results from the fourth quarter and full year ended December ... access the audio webcast or use the conference ... ...
(Date:2/22/2017)... Scientists propose in Nature blocking ... Gaucher and maybe other lysosomal storage diseases as a ... current therapies. An international research team led ... also included investigators from the University of Lübeck in ... 22. The study was conducted in mouse models of ...
Breaking Biology Technology: