PCNA Immunohistochemistry Assay Kit from Invitrogen

... raised against a partial recombinant FES. ... a.a. ~ 250 a.a) partial recombinant protein ... Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA Accession: ... Number: AAH35357 OMIM: ...

Mouse polyclonal antibody raised against a partial recombinant PREB. NCBI Entrez Gene ID = 10113...

Mouse monoclonal antibody raised against a full length recombinant GPT. NCBI Entrez Gene ID = GPT...

Rabbit polyclonal antibody to GluR2...

Biology Products:

Mouse Anti-FES Polyclonal Antibody, Unconjugated from Abnova Corporation Mouse Anti-Human PREB Polyclonal Antibody, Unconjugated from Abnova Corporation Mouse Anti-Human GPT Monoclonal Antibody, Unconjugated, Clone 4E2 from Abnova Corporation Rabbit Anti-GluR2 Polyclonal Antibody, Unconjugated from Novus Biologicals

(Date:6/19/2013)... Course at the Marine Biological Laboratory (MBL), Woods ... Microbiology site by the American Society for Microbiology ... recognizes institutions and the scientists who worked there ... science of microbiology. A ceremony unveiling the ... for Saturday, June 22, 2013, at 4:30 pm ...

(Date:6/19/2013)... University of Pittsburgh has developed antibacterial compounds, derived ... be potential treatments for drug-resistant bacterial infections and ... are quite small, making them inexpensive and easy ... June 2013 issue of the journal Antimicrobial ... many probable applications will likely be the chronic ...

(Date:6/19/2013)... June 19, 2013 A decade-long JDRF-funded study ... Helmholtz Zentrum Mnchen, Germany, is providing a deeper ... risk of developing type 1 diabetes (T1D), highlighting ... for the disease. The study, "Seroconversion to Multiple ... in Children," was published today in The ...

Breaking Biology News(10 mins):Microbial diversity course designated as a 'Milestones in Microbiology' site 2 HIV-derived antibacterial shows promise against drug-resistant bacteria 2 New data on islet autoantibodies in young children defines early type 1 diabetes development 2

[0] Microbial diversity course designated as a 'Milestones in Microbiology' site [0] HIV-derived antibacterial shows promise against drug-resistant bacteria [0] New data on islet autoantibodies in young children defines early type 1 diabetes development

... that the loss of a gene called p63 accelerates aging ... many organisms, including humans. Therefore, the p63 gene is likely ... "To study how the p63 gene works, we devised a ... us right away was that these p63 deficient mice were ...

... study has followed a single humpback whale from one ... the migratory patterns of these majestic marine mammals in ... Society (WCS), the American Museum of Natural History (AMNH), ... Society's Biology Letters, a male humpback whale that was ...

... the introduction of the varicella (chicken pox) vaccine in ... have dropped dramatically, according to a study in the ... recommended for routine immunization of children aged 12 to ... in the United States, according to background information in ...

Cached Biology News:Gene loss accelerates aging 2 Genetics links whale to two different ocean basins 2 Hospitalizations because of chicken pox down dramatically since implementation of vaccine 2 Hospitalizations because of chicken pox down dramatically since implementation of vaccine 3

Gene loss accelerates aging Genetics links whale to two different ocean basins Hospitalizations because of chicken pox down dramatically since implementation of vaccine

(Date:6/18/2013)... June 18, 2013 The human skin is ... as an important human body part. Similar to the liver, ... order to function, repair and grow. Recent reports from the ... supplements, is just as important as other life supporting organs. ... aid in skin cell reproduction, increase the appearance of skin, ...

(Date:6/18/2013)... , June 18, 2013 ... using the company,s proprietary AMCA Guided Bone Regeneration (GBR) Dental ... implants. A common problem encountered when patients have ... of sufficient bone volume to house the implant. Consequently there ... bone substitute until the natural bone regenerates. The bone substitute ...

(Date:6/18/2013)... June 18, 2013 ... research firm, announces the initiation of full ... biopharmaceutical company developing and marketing products for ... (Logo: http://photos.prnewswire.com/prnh/20130417/608168) ... examining the investment merits of BioAlliance Pharma, ...

(Date:6/18/2013)... , June 18, 2013 Mapi ... (APIs), generic and innovative intermediates, and finished dosage forms based ... has been granted a United States ... Europe for the oral treatment of ... is titled Intermediate Compounds and Processes for the Preparation ...

Breaking Biology Technology:Natural Acne Remedies Through Diet, Probiotic Action Shares New Insight on What Foods May Help Lead to Clear Skin 2 RegeneCure Starts Clinical Study Using Polymeric Bone Stimulating Membrane for Dental Implants 2 RegeneCure Starts Clinical Study Using Polymeric Bone Stimulating Membrane for Dental Implants 3 Edison Expands French Healthcare Sector Coverage With Initiation of Coverage on BioAlliance Pharma 2 Edison Expands French Healthcare Sector Coverage With Initiation of Coverage on BioAlliance Pharma 3 Mapi Pharma Granted United States Patent for Pain Relief Medication "Tapentadol" 2

[0] Natural Acne Remedies Through Diet, Probiotic Action Shares New Insight on What Foods May Help Lead to Clear Skin [0] RegeneCure Starts Clinical Study Using Polymeric Bone Stimulating Membrane for Dental Implants [0] Edison Expands French Healthcare Sector Coverage With Initiation of Coverage on BioAlliance Pharma [0] Mapi Pharma Granted United States Patent for Pain Relief Medication "Tapentadol"