Navigation Links
One-Step Deparaffinization Solution from Lab Vision

ProductsOne-Step Deparaffinization Solution from Lab Vision
Company Lab Vision
Item One-Step Deparaffinization Solution
Price $150.00
Description One-Step Deparaffinization Solution is available in a ready-to-use format. This product is an easy-to-use reagent for dewaxing paraffin-embedded tissue sections prior to performing immunohistochemistry, in situ hybridization, or other analytical methods. The conventional method of paraffin removal consists of dipping the slides in a series of baths of xylene and graded alcohols. This procedure is time-consuming which takes more than 30 minutes and requires special handling, as xylene is a highly toxic chemical that emits noxious fumes. This product is a xylene-free product for the deparaffinization and rehydration of tissue sections using a single reagent. The new procedure is easy to perform and requires less than one minute.
Info Lab VisionLab Vision
47777 Warm Springs Blvd.
Fremont, CA 94539
Customer Service: 800-828-1628
Fax Number: 510-991-2826
Web Site: http://www.labvision.com
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Reverse-iT One-Step Kit, ReddyMix from ABgene
2. Beacon 2000 One-Step FP Std from Invitrogen
3. PT ModuleTM Deparaffinization and Heat-Induced Epitope Retrieval Solution (100X) from Lab Vision
4. PT ModuleTM Deparaffinization and Heat-Induced Epitope Retrieval Solution (10X) from Lab Vision
5. AAIBiotech Solutions from AAIPharma Inc.
6. NeuroCyte - Rat Neural Stem Cell Kit from Orion BioSolutions, Inc.
7. Alsevers Solution from Sigma-Aldrich
8. Tyrodes Solution, Acidic from Sigma-Aldrich
9. Geys Balanced Salt Solution (GBSS) from Sigma-Aldrich
10. Cartesian Honeybee System for protein crystallization from Genomic Solutions
11. Earles Balanced Salt Solution, 10x (EBSS) from Sigma-Aldrich
... Mouse monoclonal antibody raised ... Immunogen: ... 206 a.a) partial recombinant protein ... Accession Number: NM_005802 ...
Mouse monoclonal antibody raised against a full length recombinant SNAPC5. NCBI Entrez Gene ID = SNAPC5...
... monoclonal antibody raised against a partial recombinant NFKBIB. ... a.a. ~ 145 a.a) partial recombinant protein with ... EDGDTALHLAVIHQHEPFLDFLLGFSAGTEYMDLQNDLGQTALHLAAILGETSTVEKLYAAGAGLCVAERRGHTALHLACRVGAHACARA Accession: BC015528 ... OMIM: 604495, ...
... Perm/Wash Buffer I can be used in ... to permeabilize cells and to serve as ... Because saponin-mediated cell permeabilization is a reversible ... cells in the presence of saponin during ...
Biology Products:
(Date:5/23/2017)...  Hunova, the first robotic gym for the rehabilitation and functional motor ... Genoa, Italy . The first 30 robots will be ... USA . The technology was developed and patented at the ... spin-off Movendo Technology thanks to a 10 million euro investment from entrepreneur ... ...
(Date:4/19/2017)... 2017 The global military biometrics ... marked by the presence of several large global players. ... five major players - 3M Cogent, NEC Corporation, M2SYS ... nearly 61% of the global military biometric market in ... global military biometrics market boast global presence, which has ...
(Date:4/11/2017)... April 11, 2017 Crossmatch®, a globally-recognized ... solutions, today announced that it has been awarded ... Projects Activity (IARPA) to develop next-generation Presentation Attack ... "Innovation has been a driving force within ... will allow us to innovate and develop new ...
Breaking Biology News(10 mins):
(Date:8/11/2017)... ... ... Algenist continues to disrupt the skincare industry with today’s debut of GENIUS Liquid ... the key structural element skin needs to maintain its youthful appearance and Algenist is ... First to market with proprietary collagen water active , Active ...
(Date:8/10/2017)... ... August 09, 2017 , ... Teachers from three Philadelphia middle ... 14th through the 16th, the University City Science Center will kick off the ... provides Philadelphia-based middle school educators an opportunity for professional development related to STEM ...
(Date:8/10/2017)... ... August 09, 2017 , ... Okyanos Center for Regenerative Medicine has announced its ... Hotel in Freeport, Grand Bahama on September 27, 2017. This daytime event is free ... from the Ministry of Health’s National Stem Cell Ethics Committee (NSCEC) and regulations laid ...
(Date:8/10/2017)... USA, and CARDIFF, UK (PRWEB) , ... August ... ... and photonics, has announced an agreement establishing Kinokuniya Company Ltd. as its exclusive ... SPIE as the exclusive sales representative for the SPIE Digital Library in Japan. ...
Breaking Biology Technology: