Navigation Links
Normal Pooled Human Serum from Innovative Research

ProductsNormal Pooled Human Serum from Innovative Research
Company Innovative Research
Item Normal Pooled Human Serum
Price $28.00
Description Normal Pooled Human Serum • Human serum is obtained from normal human donors who are found to be negative by a test for Human Immunodeficiency Virus Antigen (s) (HIV-1Ag), Antibodies to Human Immunodeficiency Virus (Anti-HIV 1/2), Hepatitis C Virus (HCV), and Nonreactive for Hepatitis B Surface Antigen (HbsAg) and Non-reactive by a screening test for syphilis. Sera are pooled from multiple donors.

Available Anticoagulants:
  • N-02: Citrate
  • N-03: Alsevers
  • N-04: Heparin (Na)
  • N-05: ACD
  • N-06: K2EDTA
  • N-07: CPD
  • N-08: K3EDTA
  • N-09: EDTA (Na)
  • N-10: Heparin (K)
Info Innovative ResearchInnovative Research
21315 Hilltop
Southfield, MI 48034

Call Innovative Research to buy products (US and Canada only; other locations use numbers below)
USA Canada 1-248-809-1136
Customer Service: (248) 353-4853
Fax Number: (248) 353-4929
Web Site: http://www.innov-research.com/
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Normal Rabbit Tissues from CHEMICON
2. Normal Rabbit Tissues from CHEMICON
3. Normal Human Serum-Single Donor from Innovative Research
4. Normal Guinea Pig Serum from IDS Ltd
5. TRIMMER cDNA Normalization Kit from Evrogen JSC
6. Dr. P Set - Monkey (Cynomolgus) Normal Tissue: Small Intestine from BioChain
7. Dr. P Set - Human Fetal Normal Tissue: Umbilical Cord from BioChain
8. Rat Normal IgM , AF647 Conjugated/Tagged from Santa Cruz Biotechnology, Inc.
9. Total Protein Western Blots - Plant Normal Tissue, Blot I from BioChain
10. Normal Goat Serum from Calbiochem
11. Normal Human Serum from CHEMICON
... Knockout System provides optimized reagents and protocols ... bacterial genes by insertion of group II ... of group II introns and utilizes a ... group II intron for specific insertion into ...
... monoclonal antibody raised against a partial recombinant MAK. ... a.a. ~ 457 a.a) partial recombinant protein with ... PPKQQSQEKPPQTLFPSIVKNMPTKPNGTLSHKSGRRRWGQTIFKSGDSWEELEDYDFGASHSKKPSMGVFKEKRKKDSPFRQQVKMAVISLSAHQFPTL Accession: BC039825 ... OMIM: 154235, ...
...
Mouse polyclonal antibody raised against a partial recombinant DDEF2. NCBI Entrez Gene ID = 8853...
Biology Products:
(Date:9/16/2014)... to make ethical choices such as buying clothing not ... fair-trade coffee, and bringing their own bags when they ... Journal of Consumer Research , ethical consumption is ... emotions about unethical practices into action. , "Advocates of ... and human costs of the products they choose, but ...
(Date:9/16/2014)... practically all vital functions in an organism. For ... particular substances and control immune system responses. Researchers ... function independently of each other, but instead form ... networks, you find many similarities with online social ... of Plant Systems Biology. "Some proteins are good ...
(Date:9/16/2014)... , Sept. 16, 2014  Cross Match Technologies, ... solutions, announced today the launch of its Verifier ... the identity of an individual using their secure ... Sentry rapidly reads credential documents with embedded biometric ... matching the biometric to a live scan of ...
Breaking Biology News(10 mins):Why are consumers willing to spend more money on ethical products? 2Good networkers make prime targets 2Cross Match Launches New Identity Management Handheld Solution 2
... Children's Hospital of Philadelphia leads a multi-center $6.7 million ... of Mental Health (NIMH) to explore a novel approach ... studies and clinical trials in adult patients, the new ... human immunodeficiency virus: sites on immune cells known as ...
... found Envisat's MERIS sensor can detect coral bleaching ... could potentially monitor impacted coral reefs worldwide on ... symbiotic algae living in symbiosis with living coral ... expelled. The whitening coral may die with subsequent ...
... what happens in cells is the work of machines that ... human and other genomes, researchers now have a nearly complete ... manual telling where all the pieces go. A new study ... to answer this question for some of the smallest and ...
Cached Biology News:Federal grant funds research on novel HIV therapy 2Federal grant funds research on novel HIV therapy 3Health of coral reefs detected from orbit 2Many needles, many haystacks 2
(Date:9/16/2014)... Valley, Arizona (PRWEB) September 16, 2014 ... that develops safe and effective products to treat ... the use of a proprietary SPACEā„¢ Technology Platform ... Officer and President will present at the White ... 2014 at the Hyatt Regency Phoenix. In ...
(Date:9/16/2014)... , Sept. 16, 2014  Ascendis Pharma ... TransCon technology to address significant unmet medical needs, ... Phase 2 pediatric study to evaluate once-weekly TransCon ... or GHD.  The full interim results will be ... GRS and IGF Society, being held October 15-18, ...
(Date:9/16/2014)... According to Jeff Howell, Partner of Nidea ... new development in Downtown Toronto is expanding at a ... 755 storeys of new development last week (including three ... dominating the Toronto skyline for the foreseeable future in ... for new development. , As the Toronto city council ...
(Date:9/15/2014)... GREENBELT, Md. , Sept. 15, 2014 /PRNewswire/ ... a leading innovator of scientific products and services ... government-wide One Acquisition Solution for Integrated Services (OASIS) ... Service (FAS). GST was selected to provide the ... in the Small Business (SB) category in Pool ...
Breaking Biology Technology:Convoy Therapeutics to Present at WhiteHat Investor Conference September 18, 2014 2Convoy Therapeutics to Present at WhiteHat Investor Conference September 18, 2014 3Ascendis Pharma A/S Announces Positive Interim Results from a Phase 2 Pediatric Study of Once-Weekly TransCon Growth Hormone for the Treatment of Growth Hormone Deficiency 2Ascendis Pharma A/S Announces Positive Interim Results from a Phase 2 Pediatric Study of Once-Weekly TransCon Growth Hormone for the Treatment of Growth Hormone Deficiency 3Ascendis Pharma A/S Announces Positive Interim Results from a Phase 2 Pediatric Study of Once-Weekly TransCon Growth Hormone for the Treatment of Growth Hormone Deficiency 4ITRA Global Reports Downtown Toronto Real Estate Development is in High Gear 2ITRA Global Reports Downtown Toronto Real Estate Development is in High Gear 3Global Science & Technology, Inc. Awarded GSA OASIS Small Business Contract 2Global Science & Technology, Inc. Awarded GSA OASIS Small Business Contract 3