Navigation Links
Mouse Granzyme B ELISpot Kit from R&D Systems

ProductsMouse Granzyme B ELISpot Kit from R&D Systems
Company R&D Systems
Item Mouse Granzyme B ELISpot Kit
Price $440.00
Description 
Info R&D SystemsR&D Systems
R&D Systems, Inc.
614 McKinley Place N.E.
Minneapolis, MN 55413
Customer Service: 1 (800) 343-7475
1 (612) 379-2956

Fax Number: 1 (612) 656-4400
Web Site: http://www.rndsystems.com
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Mouse Anti-Amodiaquine Monoclonal Antibody, Unconjugated, Clone 6D10 from AntibodyShop A/S
2. Mouse Anti-Protein S Monoclonal Antibody, Unconjugated, Clone HYB 232-02 from Abcam
3. Mouse Anti-Mouse Glutathione S-transferase M1 (GSTM1) Monoclonal Antibody, Unconjugated from Lifespan Biosciences
4. Mouse Anti-Human S-100 alpha/beta chain Monoclonal Antibody, Unconjugated, Clone 8B10 from Santa Cruz Biotechnology, Inc.
5. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Testis from OriGene Technologies
6. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Brain (adult) from OriGene Technologies
7. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (12.5 - day) from OriGene Technologies
8. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (19 - day) from OriGene Technologies
9. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Thymus from OriGene Technologies
10. Mouse Anti-Human Complement factor B Monoclonal Antibody, Unconjugated, Clone 9B6 from AntibodyShop A/S
11. Mouse Anti-Human Choriongonadotropin (hCG) Monoclonal Antibody, Unconjugated, Clone 5F10 from AntibodyShop A/S
... proteins in polyacrylamide gel after SDS ... ng of protein) with *CoomassieR-G250. All ... can be performed in 1.5 hr. ... proteins can be seen before destaining. ...
Mouse monoclonal antibody raised against a partial recombinant PASK. NCBI Entrez Gene ID = PASK...
Mouse monoclonal antibody raised against a partial recombinant CRKRS. NCBI Entrez Gene ID = CRKRS...
... a partial recombinant FES. ... 250 a.a) partial recombinant protein with GST ... WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA Accession: BC035357 ... AAH35357 OMIM: 190030, ...
Biology Products:
(Date:2/21/2017)... LONDON , February 21, 2017 ... um 70 Millionen US-Dollar wachsen. Nach einem Gespräch mit mehr ... es einige Hindernisse zu überwinden gilt, um diese Prognose ... ... unter anderem die Mobilisierung der finanziellen Mittel für die ...
(Date:2/13/2017)... 2017 Former 9/11 Commission border counsel and ... Janice Kephart of Identity Strategy Partners, LLP, today ... "Executive Order: Protecting the Nation From Foreign Terrorist ... "As President Trump,s ,Travel Ban, Executive Order gains ... banned the travel ban, it is important that our ...
(Date:2/8/2017)...  Aware, Inc. (NASDAQ: AWRE ), a leading ... for its quarter and year ended December 31, 2016. ... $3.9 million compared to $6.9 million in the same quarter ... was $0.6 million compared to $2.6 million in the fourth ... 2016 was $0.5 million, or $0.02 per diluted share, which ...
Breaking Biology News(10 mins):
(Date:3/22/2017)... --  iSpecimen ®, the marketplace for human ... (DPS), a full-service anatomic pathology reference lab serving ... , has joined a program offered by iSpecimen ... to make human biospecimens and associated data available to ... in 2015 as a collaboration between iSpecimen and DHIN, ...
(Date:3/22/2017)... , March 22, 2017 MarketNewsUpdates.com ... ... cancer conditions are being pressured as of late due to ... cancer pain management has a dramatic impact on patient,s quality ... and development activities for identifying new forms of opioid formulations ...
(Date:3/22/2017)... March 22, 2017   Boston Biomedical , an ... designed to target cancer stemness pathways, today announced its ... as Chief Executive Officer, effective April 24, 2017. ... J. Li , M.D., FACP, who has led Boston ... Under his leadership, Boston Biomedical has grown from a ...
(Date:3/22/2017)... (PRWEB) , ... March 21, 2017 , ... Premier executive ... & Life Science Search Firm by Hunt Scanlon Media. , Hunt Scanlon ... and the most widely referenced global news source in the human capital sector. , ...
Breaking Biology Technology: