Navigation Links
Mouse Anti-ZFHX4 Polyclonal Antibody, Unconjugated from Abnova Corporation

ProductsMouse Anti-ZFHX4 Polyclonal Antibody, Unconjugated from Abnova Corporation
Company Abnova Corporation
Item Mouse Anti-ZFHX4 Polyclonal Antibody, Unconjugated
Price 
Description Mouse polyclonal antibody raised against a partial recombinant ZFHX4.
Immunogen: ZFHX4 (NP_078997, 2 a.a. ~ 94 a.a) partial recombinant protein with GST tag.
Accession Number: NM_024721
Protein Sequence: ETCDSPPISRQENGQSTSKLCGTTQLDNEVPEKVAGMEPDRENSSTDDNLKTDERKSEALLGFSVENAAATQVTSAKEIPCNECATSFPSLQ*
Info Abnova CorporationAbnova Corporation
Abnova Corporation (HQ)
9th Fl., No. 108, Jhouzih St.
Neihu District, Taipei
114 Taiwan R.O.C.
Tel: +886-2-8751-1888
Fax: +886-2-8751-1166

Abnova GmbH
Boxbergring 107
69126 Heidelberg
Germany
Tel: +49 6221 3632226
Fax: +49 6221 825878

Customer Service: +886-2-8751-1888
Fax Number: +886-2-8751-1166
Web Site: http://www.abnova.com.tw
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Mouse Anti-Amodiaquine Monoclonal Antibody, Unconjugated, Clone 6D10 from AntibodyShop A/S
2. Mouse Anti-Protein S Monoclonal Antibody, Unconjugated, Clone HYB 232-02 from Abcam
3. Mouse Anti-Mouse Glutathione S-transferase M1 (GSTM1) Monoclonal Antibody, Unconjugated from Lifespan Biosciences
4. Mouse Anti-Human S-100 alpha/beta chain Monoclonal Antibody, Unconjugated, Clone 8B10 from Santa Cruz Biotechnology, Inc.
5. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Testis from OriGene Technologies
6. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Brain (adult) from OriGene Technologies
7. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (12.5 - day) from OriGene Technologies
8. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (19 - day) from OriGene Technologies
9. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Thymus from OriGene Technologies
10. Mouse Anti-Human Complement factor B Monoclonal Antibody, Unconjugated, Clone 9B6 from AntibodyShop A/S
11. Mouse Anti-Human Choriongonadotropin (hCG) Monoclonal Antibody, Unconjugated, Clone 5F10 from AntibodyShop A/S
15(S)-HEDE is produced from 11Z,14Z-eicosadienoic acid by 15-LO. 15(S)-HEDE is an inhibitor of RBL-1 cell 5-LO with an IC50 value of 26 µM....
Mouse monoclonal [HYB 232-02] to Protein S ( Abpromise for all tested applications). entrezGeneID: 5627 SwissProtID: P07225...
Simple operation and an easy-to-read LCD display characterize our Classic Light balances. * Taring range 0...1510 g...
... SLi 3 •3H 2 O Formula Weight: 881.42 ... pH 7.0): greater than or equal to 90% lambda max : 259 ... Spectral Ratios: A 232 /A 260 : 0.51 ... 280 /A 260 : 0.17 0.02 Storage: -20C ...
Biology Products:
(Date:8/28/2014)... PAUL (August 28, 2014) Researchers at the University ... facioscapulohumeral muscular dystrophy (FSHD) to be used for muscle ... of potential therapies for FSHD. , The research is ... Cell Reports . , There is no treatment for ... most common type of muscular dystrophy. FSHD is an ...
(Date:8/28/2014)... 28, 2014  Privacy Advocate and Senior Staff Attorney ... , joins the lineup of biometric and mobile commerce ... UnPlugged Executive Summit in Tampa, Florida ... announced speakers include Steven Rahman, Director, Technology and Strategy at ... Experian. The theme of this year,s event is Mobility ...
(Date:8/28/2014)... new method for measuring and imaging how quickly blood ... better understand how drug abuse affects the brain, which ... and lead to better treatment options for recovering drug ... researchers from Stony Brook University in New York, USA ... today in The Optical Society,s (OSA) open-access journal ...
Breaking Biology News(10 mins):UMN researchers find animal model for understudied type of muscular dystrophy 2Biometrics UnPlugged Welcomes the Electronic Frontier Foundation's Jennifer Lynch to the Mobility at the Crossroads of Commerce and Privacy Summit 2This is your brain's blood vessels on drugs 2This is your brain's blood vessels on drugs 3
... Consumption of foods high in carbohydrates immediately after birth ... University at Buffalo animal study has found, even if caloric ... The research on laboratory animals was published this month ... ; it was published online in December. "This is ...
... Braconidae are known for their deadly reproductive habits. Most ... in other insects and their larvae, eventually killing the respective ... sterility. Three new species of the parasitoid wasp genus ... Hymenoptera Research , reflect this fatal behavior. Two ...
... Trademark Office today awarded St. Jude Children,s Research Hospital ... compositions for genetically modifying human immune cells so they ... cancer in children and adults. "This ... attack certain cells that cause leukemia and lymphoma, cancers ...
Cached Biology News:High-carb intake in infancy has lifelong effects, UB study finds 2High-carb intake in infancy has lifelong effects, UB study finds 3Kill Bill character inspires the name of a new parasitoid wasp species 2St. Jude Children's Research Hospital announces issuance of US patent for cancer therapy 2
(Date:8/29/2014)... A major challenge before new biotechnology start-up companies, ... Boston-Cambridge, is gaining visibility that can lead to important ... of Boston’s Adult Stem Cell Technology Center, LLC (ASCTC), ... his company an important priority since he started the ... social media marketing campaign launched earlier in ...
(Date:8/28/2014)... Nevada City, CA (PRWEB) August 28, 2014 ... and sanitation products for the food processing industry, is ... conducting a side-by side comparison of the E2 soap ... Q E2 Sanitizing Foam Soap . Hand hygiene ... pathogens in the food processing environment. Six key criteria ...
(Date:8/28/2014)... research platform uses a laser to measure ... stress and heating, an approach likely to ... and batteries., This new technique, called nanomechanical ... and the surface stress of microscale structures ... the merits of surface-stress influence on mechanical ...
(Date:8/28/2014)... August 28, 2014 The ability for ... culture that will allow individuals to perform at the ... important for employers looking to compete in this post–recession ... embracing this trend, as the sector increasingly focuses on ... company, which will have real results on the organization's ...
Breaking Biology Technology:The Adult Stem Cell Technology Center, LLC Participates in Multiple Stem Cell and Regenerative Medicine Conferences Before Year End 2The Adult Stem Cell Technology Center, LLC Participates in Multiple Stem Cell and Regenerative Medicine Conferences Before Year End 3The Adult Stem Cell Technology Center, LLC Participates in Multiple Stem Cell and Regenerative Medicine Conferences Before Year End 4Best Sanitizers, Inc. Asks Food Industry Professionals: With Fall Harvest On the Way, Is Your E2 Hand Soap Up to the Task? 2New analytical technology reveals 'nanomechanical' surface traits 2New analytical technology reveals 'nanomechanical' surface traits 3Klein Hersh International Leads Philadelphia Area Life Science Industry in Company Culture 2Klein Hersh International Leads Philadelphia Area Life Science Industry in Company Culture 3