Navigation Links
Mouse Anti-ZFHX4 Polyclonal Antibody, Unconjugated from Abnova Corporation

ProductsMouse Anti-ZFHX4 Polyclonal Antibody, Unconjugated from Abnova Corporation
Company Abnova Corporation
Item Mouse Anti-ZFHX4 Polyclonal Antibody, Unconjugated
Price 
Description Mouse polyclonal antibody raised against a partial recombinant ZFHX4.
Immunogen: ZFHX4 (NP_078997, 2 a.a. ~ 94 a.a) partial recombinant protein with GST tag.
Accession Number: NM_024721
Protein Sequence: ETCDSPPISRQENGQSTSKLCGTTQLDNEVPEKVAGMEPDRENSSTDDNLKTDERKSEALLGFSVENAAATQVTSAKEIPCNECATSFPSLQ*
Info Abnova CorporationAbnova Corporation
Abnova Corporation (HQ)
9th Fl., No. 108, Jhouzih St.
Neihu District, Taipei
114 Taiwan R.O.C.
Tel: +886-2-8751-1888
Fax: +886-2-8751-1166

Abnova GmbH
Boxbergring 107
69126 Heidelberg
Germany
Tel: +49 6221 3632226
Fax: +49 6221 825878

Customer Service: +886-2-8751-1888
Fax Number: +886-2-8751-1166
Web Site: http://www.abnova.com.tw
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Mouse Anti-Amodiaquine Monoclonal Antibody, Unconjugated, Clone 6D10 from AntibodyShop A/S
2. Mouse Anti-Protein S Monoclonal Antibody, Unconjugated, Clone HYB 232-02 from Abcam
3. Mouse Anti-Mouse Glutathione S-transferase M1 (GSTM1) Monoclonal Antibody, Unconjugated from Lifespan Biosciences
4. Mouse Anti-Human S-100 alpha/beta chain Monoclonal Antibody, Unconjugated, Clone 8B10 from Santa Cruz Biotechnology, Inc.
5. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Testis from OriGene Technologies
6. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Brain (adult) from OriGene Technologies
7. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (12.5 - day) from OriGene Technologies
8. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (19 - day) from OriGene Technologies
9. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Thymus from OriGene Technologies
10. Mouse Anti-Human Complement factor B Monoclonal Antibody, Unconjugated, Clone 9B6 from AntibodyShop A/S
11. Mouse Anti-Human Choriongonadotropin (hCG) Monoclonal Antibody, Unconjugated, Clone 5F10 from AntibodyShop A/S
...can be used as a fully functional, stand-alone ins...vides the means to record and tabulate data import...en be copied and pasted into commercially availabl...23, or into a curve-fitting program. The Data Mana...
...t Gasket slide kit (1x 22K gasket/slide) G2534-6...t/slide) G2534-60002 This unique set of disposabl...array feature formats, accommodate both Agilent ol... fabricated and batch tested to ensure performance...
This CLS number is a new product number, created to easily match Cornings product number. If showing no availability yet, please order under the old Sigma-Aldrich number (Z71,346-5) or contact custom
General description: self locking design in ice/water bath This CLS number is a new product number, created to easily match Cornings product number. If showing no availability yet, please order under
Biology Products:
(Date:10/9/2008)... of patients with compromised immune systems has g...ese require a unique set of healthcare solutions t...iology and degree of immune suppression to the ind...rom ASM Press, Diagnostic Microbiology of the Immu...oaches and challenges to infectious disease diagno...
(Date:10/9/2008)...tious Diseases (NIAID), part of the National Insti...cts estimated to be up to $68.7 million to establi...ase Research at four research institutions. Scient...to study diseases that include severe acute respir... , Systems biology is the study of the network o...
(Date:10/9/2008)...s a cornerstone of Frontiers in Optics 2008 (FiO),...SA), being held Oct. 19-23 at the Riverside Conven... place alongside Laser Science XXIV, the annual me...of Laser Science. , Reporters interested in obta... Colleen Morrison at 202.416.1437, cmorri@osa.org...
(Date:10/9/2008)... are launching a new project that will standardize...ghout the state, decrease the cost of providing th...ic scientists, and hopefully contribute to the est...tigations. , A team of NC State scientists, led ...U.S. Department of Justice,s National Institute of...
Breaking Biology News(10 mins):Text focuses on diagnosing infections in immunocompromised patients 2New Systems Biology Awards enable detailed study of microbes 2Where optics meets medicine 2Where optics meets medicine 3Where optics meets medicine 4Where optics meets medicine 5Where optics meets medicine 6Where optics meets medicine 7NC State takes lead in crime scene investigation training 2NJ Based Surgeon Helps Pioneer Dramatic Advance in Treating Damaged Discs 2731 1NJ Based Surgeon Helps Pioneer Dramatic Advance in Treating Damaged Discs 2731 2Pandemic research receives 241 6M funding boost 24508 1Pandemic research receives 241 6M funding boost 24508 2Acidification of the sea hampers reproduction of marine species 4245 1Acidification of the sea hampers reproduction of marine species 4245 2Scientists in Hungary and Portugal get research boost 4243 1Scientists in Hungary and Portugal get research boost 4243 2
...ns in the Canadian Rockies are stifling the mating...ity of Alberta researchers. , Smaller and less abu...activities--are diminishing the alpine butterfly g...e butterflies being less able to survive, said Dr....sity of Alberta and an author of a paper on the su...
...lity to discern the ancient evolutionary relations...functions, researchers have provided insight into ...on that occurred over a hundred million years ago ...ted in Current Biology by a team led by Brendan Da...uplication--a relatively uncommon event in which a...
...ane Katrina, scientists and research centers from ...mation on the contaminated floodwaters and offer i... officials. , In a matter of hours, the University...s Program and Renaissance Computing Institute (REN...mputing Applications (NCSA), played a key role in ...
...c repositories for DNA and RNA sequence informatio...s; the ,letters, of the genetic code] of sequence....aved the way for the global exchange of many types...he International Nucleotide Sequence Database Coll...ank [Hinxton, UK], GenBank [Bethesda, USA] and the...
Other Biology News:Expanding forests darken the outlook for butterflies, study shows 2Analysis of flower genes reveals the fate of an ancient gene duplication 2UNC computer, marine scientists collaborate to predict flow of toxic waters from Katrina 2UNC computer, marine scientists collaborate to predict flow of toxic waters from Katrina 3Public collections of DNA and RNA sequence reach 100 gigabases 2Public collections of DNA and RNA sequence reach 100 gigabases 3
(Date:10/9/2008)...w analytical tools coming on line at the Spallatio...-of-the-art neutron science facility at Oak Ridge ... to nuclear physics studies. , The Fundamental N...tter to receive neutrons for the first time. Among...intense beam line are experiments that probe the n...
(Date:10/9/2008)...come Excluding Non-Cash Charges, SAN DIEGO, Oct. ...:,CDIC), the innovator and leader of BioZ(R) Imped... financial results for fiscal third quarter 2008.,...d with Third Quarter 2007 -- Net ICG sales increa...nternational sales increased 35% to $690,000, up f...
(Date:10/9/2008)...n of Qoustic Wound Therapy System(R), MINNEAPOLIS...leader in,advanced ultrasonic wound care devices, ... CEO Eliaz Babaev, Ph.D., has been issued a U.S.,p...generation of the,company,s Qoustic Wound Therapy ...ch offers a safe, cost-effective,alternative to pa...
(Date:10/9/2008)...ire-FirstCall/ -- Environmental,Tectonics Corporat...dical,Division today announced the sale of three (...Chambers to Comprehensive Healthcare Solutions, In... company who focuses,solely on initiating and oper...ed States, has purchased a total of five (5) BARA-...
Breaking Biology Technology:Spallation Neutron Source sends first neutrons to 'Big Bang' beam line 2CardioDynamics Reports Third Quarter 2008 Results, Seventh Consecutive Quarterly Revenue Growth and 15% Year to Date Revenue Increase 2CardioDynamics Reports Third Quarter 2008 Results, Seventh Consecutive Quarterly Revenue Growth and 15% Year to Date Revenue Increase 3CardioDynamics Reports Third Quarter 2008 Results, Seventh Consecutive Quarterly Revenue Growth and 15% Year to Date Revenue Increase 4CardioDynamics Reports Third Quarter 2008 Results, Seventh Consecutive Quarterly Revenue Growth and 15% Year to Date Revenue Increase 5CardioDynamics Reports Third Quarter 2008 Results, Seventh Consecutive Quarterly Revenue Growth and 15% Year to Date Revenue Increase 6Arobella Medical CEO is Issued U.S. Patent for Ultrasound Wound Therapy Technology 2Environmental Tectonics Corporation Announces a Multiple Sale of Hyperbaric Monoplace Chambers to Comprehensive Healthcare Solutions 2Environmental Tectonics Corporation Announces a Multiple Sale of Hyperbaric Monoplace Chambers to Comprehensive Healthcare Solutions 3Environmental Tectonics Corporation Announces a Multiple Sale of Hyperbaric Monoplace Chambers to Comprehensive Healthcare Solutions 4
...-Gov. Lee Dreyfus made a few waves when he suggest...ecome "the blue-eyed Arabs of the Upper Midwest" b... Sunbelt. , ,Like many of his ideas, often delive...thought about them, this Dreyfus proposal simultan... Middle Eastern sheiks and Texas oil barons hold W...
...y this week: I have a number of juicy topics I wan...ipation in the annual Israel biotech/medical devic...n meetings about Indian and my growing insights in... and other research that has crossed my transom (i...on why I originally wanted to start writing this c...
...sin,s two largest cities are moving closer to prov...ographic limits, and several others continue to bu... localized wireless "hot-spots" offered in public ...Madison, Milwaukee, Waukesha, and Shawano continue...unicipal wireless networks. , , Mad world , ,With...
... remotely hosted technology released by GE Health... and some rural Wisconsin healthcare facilities al...ecords with a hosted model. , ,GE,s new remote hos...s (CERS), is designed to enable comprehensive med...dably. The integration and deployment of CERS will...
Other Biology Technology:Fresh water could be a deep economic wellspring for Wisconsin 2Fresh water could be a deep economic wellspring for Wisconsin 3The world of in vitro diagnostics is another Midwest success story 2The world of in vitro diagnostics is another Midwest success story 3The world of in vitro diagnostics is another Midwest success story 4The world of in vitro diagnostics is another Midwest success story 5The world of in vitro diagnostics is another Midwest success story 6Wisconsin cities make progress on wireless Internet coverage 2Wisconsin cities make progress on wireless Internet coverage 3Wisconsin cities make progress on wireless Internet coverage 4GE introduces remotely hosted health services 2GE introduces remotely hosted health services 3GE introduces remotely hosted health services 4