Navigation Links
Mouse Anti-ZFHX4 Polyclonal Antibody, Unconjugated from Abnova Corporation

ProductsMouse Anti-ZFHX4 Polyclonal Antibody, Unconjugated from Abnova Corporation
Company Abnova Corporation
Item Mouse Anti-ZFHX4 Polyclonal Antibody, Unconjugated
Price 
Description Mouse polyclonal antibody raised against a partial recombinant ZFHX4.
Immunogen: ZFHX4 (NP_078997, 2 a.a. ~ 94 a.a) partial recombinant protein with GST tag.
Accession Number: NM_024721
Protein Sequence: ETCDSPPISRQENGQSTSKLCGTTQLDNEVPEKVAGMEPDRENSSTDDNLKTDERKSEALLGFSVENAAATQVTSAKEIPCNECATSFPSLQ*
Info Abnova CorporationAbnova Corporation
Abnova Corporation (HQ)
9th Fl., No. 108, Jhouzih St.
Neihu District, Taipei
114 Taiwan R.O.C.
Tel: +886-2-8751-1888
Fax: +886-2-8751-1166

Abnova GmbH
Boxbergring 107
69126 Heidelberg
Germany
Tel: +49 6221 3632226
Fax: +49 6221 825878

Customer Service: +886-2-8751-1888
Fax Number: +886-2-8751-1166
Web Site: http://www.abnova.com.tw
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Mouse Anti-Amodiaquine Monoclonal Antibody, Unconjugated, Clone 6D10 from AntibodyShop A/S
2. Mouse Anti-Protein S Monoclonal Antibody, Unconjugated, Clone HYB 232-02 from Abcam
3. Mouse Anti-Mouse Glutathione S-transferase M1 (GSTM1) Monoclonal Antibody, Unconjugated from Lifespan Biosciences
4. Mouse Anti-Human S-100 alpha/beta chain Monoclonal Antibody, Unconjugated, Clone 8B10 from Santa Cruz Biotechnology, Inc.
5. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Testis from OriGene Technologies
6. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Brain (adult) from OriGene Technologies
7. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (12.5 - day) from OriGene Technologies
8. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (19 - day) from OriGene Technologies
9. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Thymus from OriGene Technologies
10. Mouse Anti-Human Complement factor B Monoclonal Antibody, Unconjugated, Clone 9B6 from AntibodyShop A/S
11. Mouse Anti-Human Choriongonadotropin (hCG) Monoclonal Antibody, Unconjugated, Clone 5F10 from AntibodyShop A/S
... Whether your protein is in solution or in ... MALDI-TOF/TOF mass spectrometry. Proteins will be digested to ... (mass) of the peptides are determined by MALDI-TOF, ... 10 peaks (peptides) from MALDI-TOF will be determined ...
OmniSlide Heated Wash Module. 2 independent chambers with precise temperature control from ambient of 5C to 70C. Each chamber holds 1 slide rack (20 slides). Includes 2 x Wash Sleeves, 1 x Slide R...
For cleavage of 6xHis tags from proteins containing a Factor Xa Protease recognition site Efficient 6xHis tag cleavage (greater than 90%), ...
Request Info...
Biology Products:
(Date:4/19/2017)... 19, 2017 The global military ... is marked by the presence of several large global ... by five major players - 3M Cogent, NEC Corporation, ... for nearly 61% of the global military biometric market ... the global military biometrics market boast global presence, which ...
(Date:4/17/2017)... Florida , April 17, 2017 NXT-ID, ... technology company, announces the filing of its 2016 Annual Report on ... and Exchange Commission. ... on Form 10-K is available in the Investor Relations section of ... as on the SEC,s website at http://www.sec.gov . ...
(Date:4/13/2017)... According to a new market research report "Consumer IAM Market by Solution ... Authentication Type, Deployment Mode, Vertical, and Region - Global Forecast to 2022", ... 14.30 Billion in 2017 to USD 31.75 Billion by 2022, at a ... ... MarketsandMarkets Logo ...
Breaking Biology News(10 mins):
(Date:8/15/2017)... NC (PRWEB) , ... August 15, 2017 , ... ... 2017, celebrating 10 years of successes helping medical technology companies and inventors develop and ... to a renowned full-service national engineering firm with a portfolio of clients in the ...
(Date:8/15/2017)... , ... August 15, 2017 , ... ... the largest Asian exhibitions for analytical and scientific instruments. This year’s symposium, organized ... “New Approaches in Mass Spectrometry for Bioanalytical Applications.” This dynamic presentation will discuss ...
(Date:8/15/2017)... (PRWEB) , ... August 15, 2017 , ... ... new family of 6” modular downlights designed to stay tightly sealed and perform ... areas where damp and wet location listings just aren't enough, such as: hospitals; ...
(Date:8/15/2017)... ... 15, 2017 , ... Coffea arabica accounts for 70 percent ... During this educational webinar, participants will learn about the importance of genomics for ... understanding of how genomics is important for coffee breeding improvement. , Attendees will ...
Breaking Biology Technology: