Navigation Links
Mouse Anti-ZFHX4 Polyclonal Antibody, Unconjugated from Abnova Corporation

ProductsMouse Anti-ZFHX4 Polyclonal Antibody, Unconjugated from Abnova Corporation
Company Abnova Corporation
Item Mouse Anti-ZFHX4 Polyclonal Antibody, Unconjugated
Price 
Description Mouse polyclonal antibody raised against a partial recombinant ZFHX4.
Immunogen: ZFHX4 (NP_078997, 2 a.a. ~ 94 a.a) partial recombinant protein with GST tag.
Accession Number: NM_024721
Protein Sequence: ETCDSPPISRQENGQSTSKLCGTTQLDNEVPEKVAGMEPDRENSSTDDNLKTDERKSEALLGFSVENAAATQVTSAKEIPCNECATSFPSLQ*
Info Abnova CorporationAbnova Corporation
Abnova Corporation (HQ)
9th Fl., No. 108, Jhouzih St.
Neihu District, Taipei
114 Taiwan R.O.C.
Tel: +886-2-8751-1888
Fax: +886-2-8751-1166

Abnova GmbH
Boxbergring 107
69126 Heidelberg
Germany
Tel: +49 6221 3632226
Fax: +49 6221 825878

Customer Service: +886-2-8751-1888
Fax Number: +886-2-8751-1166
Web Site: http://www.abnova.com.tw
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Mouse Anti-Amodiaquine Monoclonal Antibody, Unconjugated, Clone 6D10 from AntibodyShop A/S
2. Mouse Anti-Protein S Monoclonal Antibody, Unconjugated, Clone HYB 232-02 from Abcam
3. Mouse Anti-Mouse Glutathione S-transferase M1 (GSTM1) Monoclonal Antibody, Unconjugated from Lifespan Biosciences
4. Mouse Anti-Human S-100 alpha/beta chain Monoclonal Antibody, Unconjugated, Clone 8B10 from Santa Cruz Biotechnology, Inc.
5. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Testis from OriGene Technologies
6. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Brain (adult) from OriGene Technologies
7. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (12.5 - day) from OriGene Technologies
8. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (19 - day) from OriGene Technologies
9. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Thymus from OriGene Technologies
10. Mouse Anti-Human Complement factor B Monoclonal Antibody, Unconjugated, Clone 9B6 from AntibodyShop A/S
11. Mouse Anti-Human Choriongonadotropin (hCG) Monoclonal Antibody, Unconjugated, Clone 5F10 from AntibodyShop A/S
(Date:1/4/2017)... LAS VEGAS , Jan. 4, 2017  For the thousands of ... , a global leader in connected health and biometric measurement devices and ... pressure monitors. On display in A&D Medical,s special CES ... monitors represent the ongoing expansion of the company,s WellnessConnected product ... ...
(Date:12/20/2016)... , Dec. 20, 2016 The ... sharing, rental and leasing is stoking significant interest ... radio frequency technology, Bluetooth low energy (BLE), biometrics ... as the next wave of wireless technologies in ... access system to advanced access systems opens the ...
(Date:12/16/2016)... 2016 The global wearable medical device market, in terms ... from USD 5.31 billion in 2016, at a CAGR of 18.0% ... ... advancements in medical devices, launch of a growing number of smartphone-based ... among healthcare providers, and increasing focus on physical fitness. ...
Breaking Biology News(10 mins):
(Date:1/19/2017)... PUNE, India , Jan. 19, 2017  Market Research Future ... The Global Market for Liquid Biopsy is growing rapidly and expected ... period. Market Highlights ... The Global Liquid Biopsy Market has been assessed as ... high growth figures and boom in the coming future. There has ...
(Date:1/19/2017)... Berkeley, CA (PRWEB) , ... January 19, 2017 ... ... the delivery of product vigilance software to leading biopharmaceutical and medical device manufacturers ... Mail is a fully 21 CFR Part 11-compliant email client designed to provide ...
(Date:1/19/2017)... ... January 18, 2017 , ... LabRoots ... scientists from around the world, was today awarded the "Best Science & Technology ... entirely on merit and decided upon by a dedicated team of researchers and ...
(Date:1/19/2017)... N.Y. , Jan. 18, 2017 Acupath ... services, announces the formation of an Executive Committee that ... and beyond. John Cucci , a ... promoted from Director of Business Development to Chief ... 2015, Mr. Cucci served in senior sales leadership roles ...
Breaking Biology Technology: