Navigation Links
Mouse Anti-ZFHX4 Polyclonal Antibody, Unconjugated from Abnova Corporation

ProductsMouse Anti-ZFHX4 Polyclonal Antibody, Unconjugated from Abnova Corporation
Company Abnova Corporation
Item Mouse Anti-ZFHX4 Polyclonal Antibody, Unconjugated
Price 
Description Mouse polyclonal antibody raised against a partial recombinant ZFHX4.
Immunogen: ZFHX4 (NP_078997, 2 a.a. ~ 94 a.a) partial recombinant protein with GST tag.
Accession Number: NM_024721
Protein Sequence: ETCDSPPISRQENGQSTSKLCGTTQLDNEVPEKVAGMEPDRENSSTDDNLKTDERKSEALLGFSVENAAATQVTSAKEIPCNECATSFPSLQ*
Info Abnova CorporationAbnova Corporation
Abnova Corporation (HQ)
9th Fl., No. 108, Jhouzih St.
Neihu District, Taipei
114 Taiwan R.O.C.
Tel: +886-2-8751-1888
Fax: +886-2-8751-1166

Abnova GmbH
Boxbergring 107
69126 Heidelberg
Germany
Tel: +49 6221 3632226
Fax: +49 6221 825878

Customer Service: +886-2-8751-1888
Fax Number: +886-2-8751-1166
Web Site: http://www.abnova.com.tw
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Mouse Anti-Amodiaquine Monoclonal Antibody, Unconjugated, Clone 6D10 from AntibodyShop A/S
2. Mouse Anti-Protein S Monoclonal Antibody, Unconjugated, Clone HYB 232-02 from Abcam
3. Mouse Anti-Mouse Glutathione S-transferase M1 (GSTM1) Monoclonal Antibody, Unconjugated from Lifespan Biosciences
4. Mouse Anti-Human S-100 alpha/beta chain Monoclonal Antibody, Unconjugated, Clone 8B10 from Santa Cruz Biotechnology, Inc.
5. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Testis from OriGene Technologies
6. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Brain (adult) from OriGene Technologies
7. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (12.5 - day) from OriGene Technologies
8. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (19 - day) from OriGene Technologies
9. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Thymus from OriGene Technologies
10. Mouse Anti-Human Complement factor B Monoclonal Antibody, Unconjugated, Clone 9B6 from AntibodyShop A/S
11. Mouse Anti-Human Choriongonadotropin (hCG) Monoclonal Antibody, Unconjugated, Clone 5F10 from AntibodyShop A/S
S-100 alpha/beta chain (8B10)...
... is a new product number, created ... If showing no availability yet, please ... (Z71,487-9) or contact customer service for ... 100 mm, No. of sidearm 4 ...
... a metabolically stable analog of ... uterine stimulant and abortifacient which ... induce labor. It induces luteolysis ... when given as an intramuscular ...
TGase3 (S-20)...
Biology Products:
(Date:12/17/2014)... 16, 2014 Valencell, a leader in performance biometric ... to industry leaders such as Intel, Jabra, Atlas, and ... wearable products. These products will be showcased at CES ... Vegas . "Our partners choose ...
(Date:12/11/2014)... , Dec. 09, 2014 Research and Markets ... ( http://www.researchandmarkets.com/research/twhjll/biometrics_market ) has announced the addition of the ... to their offering. One major trend ... continuous advances in technology, it is important to upgrade ...
(Date:12/10/2014)... been here before: you desperately need to sign into your online ... answer to your secret question. What,s your dog,s birthday? Who was ... , a digital infrastructure security company, launches the app ... with usernames, passwords and PINs – 1U TM . ...
Breaking Biology News(10 mins):Valencell PerformTek Biometrics Power the Most Accurate Wearables at CES 2015 2Biometrics Market in the APAC Region 2015-2019: Key Vendors are 3M Cogent, NEC, Safran and Suprema 2The Password is Finally Dead: Launch of 1U Mobile App Eliminates Need for All Usernames and Passwords 2The Password is Finally Dead: Launch of 1U Mobile App Eliminates Need for All Usernames and Passwords 3
... four genes newly associated with severe childhood obesity. They ... in severely obese children. The team found that ... to maintain protein receptors known to be involved in ... for the development of new drugs against obesity. ...
... UNTIL 1 P.M. EDT, APRIL 7, 2013, Cleveland: A compound ... popular energy drinks has been found to promote atherosclerosis ... to Cleveland Clinic research published online this week in the ... that bacteria living in the human digestive tract metabolize the ...
... Kidney stones usually make their presence known suddenly, often ... Each year in the U.S. more than a million ... nephrolithiasis. The total annual cost of treatment exceeds $2.1 ... Information Clearinghouse. Although kidney stone pain may ...
Cached Biology News:Finding genes for childhood obesity 2Cleveland Clinic researchers discover new link between heart disease and red meat 2Cleveland Clinic researchers discover new link between heart disease and red meat 3Flies reveal kidney stones in-the-making 2Flies reveal kidney stones in-the-making 3
(Date:1/22/2015)... Diego, California (PRWEB) January 22, 2015 ... Promotional Offer to their comprehensive portfolio of Eppendorf ... allows customers to purchase a Centrifuge 5424/5424 R and ... Bundle of either Eppendorf Research plus or Eppendorf Reference ...
(Date:1/22/2015)... 22, 2015 Diagenode, Inc., a ... the Bioruptor® and complete solutions for epigenetics research, ... immunoprecipitation, alleviating the need for manual processing. The ... for ChIP of histones or transcription factors and ...
(Date:1/22/2015)... 2015  Derma Sciences, Inc. (Nasdaq: DSCI ... wound care, announces that AMNIOEXCEL® and AMNIOMATRIX®, amniotic ... to the Premier, Inc. Regenerative Skin Grafting contract ... AMNIOEXCEL® and AMNIOMATRIX® product lines, which continue to ...
(Date:12/24/2014)... Solutions , Inc. (NASDAQ: BLFS ), a leading ... storage and cryopreservation freeze media and ... or the "Company"), today announced that it will hold its ... "Annual Meeting"). Because the expected date for the ...
Breaking Biology Technology:Eppendorf Announces Promotional Bundle Which Includes: Eppendorf Centrifuge 5424, 3-Pack of Pipettes, and Tips - Available Now at Pipette.com 2Diagenode Launches Unique Semi-Automated Solution for Chromatin Immunoprecipitation 2Derma Sciences Expands Access of its AMNIOTIC TISSUE Product Line with New Premier, Inc. Agreement 2Derma Sciences Expands Access of its AMNIOTIC TISSUE Product Line with New Premier, Inc. Agreement 3Derma Sciences Expands Access of its AMNIOTIC TISSUE Product Line with New Premier, Inc. Agreement 4Derma Sciences Expands Access of its AMNIOTIC TISSUE Product Line with New Premier, Inc. Agreement 5BioLife Solutions Sets Date for Annual Meeting of Stockholders 2