Navigation Links
Mouse Anti-ZFHX4 Polyclonal Antibody, Unconjugated from Abnova Corporation

ProductsMouse Anti-ZFHX4 Polyclonal Antibody, Unconjugated from Abnova Corporation
Company Abnova Corporation
Item Mouse Anti-ZFHX4 Polyclonal Antibody, Unconjugated
Price 
Description Mouse polyclonal antibody raised against a partial recombinant ZFHX4.
Immunogen: ZFHX4 (NP_078997, 2 a.a. ~ 94 a.a) partial recombinant protein with GST tag.
Accession Number: NM_024721
Protein Sequence: ETCDSPPISRQENGQSTSKLCGTTQLDNEVPEKVAGMEPDRENSSTDDNLKTDERKSEALLGFSVENAAATQVTSAKEIPCNECATSFPSLQ*
Info Abnova CorporationAbnova Corporation
Abnova Corporation (HQ)
9th Fl., No. 108, Jhouzih St.
Neihu District, Taipei
114 Taiwan R.O.C.
Tel: +886-2-8751-1888
Fax: +886-2-8751-1166

Abnova GmbH
Boxbergring 107
69126 Heidelberg
Germany
Tel: +49 6221 3632226
Fax: +49 6221 825878

Customer Service: +886-2-8751-1888
Fax Number: +886-2-8751-1166
Web Site: http://www.abnova.com.tw
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Mouse Anti-Amodiaquine Monoclonal Antibody, Unconjugated, Clone 6D10 from AntibodyShop A/S
2. Mouse Anti-Protein S Monoclonal Antibody, Unconjugated, Clone HYB 232-02 from Abcam
3. Mouse Anti-Mouse Glutathione S-transferase M1 (GSTM1) Monoclonal Antibody, Unconjugated from Lifespan Biosciences
4. Mouse Anti-Human S-100 alpha/beta chain Monoclonal Antibody, Unconjugated, Clone 8B10 from Santa Cruz Biotechnology, Inc.
5. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Testis from OriGene Technologies
6. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Brain (adult) from OriGene Technologies
7. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (12.5 - day) from OriGene Technologies
8. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (19 - day) from OriGene Technologies
9. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Thymus from OriGene Technologies
10. Mouse Anti-Human Complement factor B Monoclonal Antibody, Unconjugated, Clone 9B6 from AntibodyShop A/S
11. Mouse Anti-Human Choriongonadotropin (hCG) Monoclonal Antibody, Unconjugated, Clone 5F10 from AntibodyShop A/S
Human sVCAM-1/CD106 ELI-PAIR Kit...
HNF-1 Purified Anti-Mouse, Anti-Rat, Anti-Rabbit, Anti-Human clone 2, Isotype Mouse IgG 1 , 50 µg Consult technical datasheet for details....
GLP-1 (HYB 147-12)...
... Services include subcloning of gene in ... cells, isolation and plaque purification of ... virus stock for one clone, protein ... insect cell culture. Expected yield and ...
Biology Products:
(Date:3/2/2017)... Australia , March 2, 2017 Australian ... Ltd (ASX: CYP), has signed an agreement with ... from the Monash Biomedicine Discovery Institute and Department of ... to conduct a further preclinical study to support the ... treatment of asthma.  Asthma is a ...
(Date:2/27/2017)...   Strategic Cyber Ventures , the industry,s first ... $3.5 million investment in  Polarity , the first commercial ... DC based and is led by cybersecurity veterans ... Ron Gula , also a longtime cybersecurity veteran and ... series A round of funding. This new funding will ...
(Date:2/21/2017)... Der weltweite Biobanking-Sektor wird bis ... Gespräch mit mehr als 50 Vertretern aus verschiedenen Branchen wurde ... um diese Prognose zu realisieren. ... Zu den Schwierigkeiten ... Mittel für die Biobank, die Implementierung Zeit sparender Technologien, ...
Breaking Biology News(10 mins):
(Date:3/22/2017)... , March 22, 2017 The ... states a research report by Transparency Market Research (TMR). ... Amgen Inc., and AbbVie Inc., accounted for a share ... prominent players in this market are focusing aggressively on ... portfolio, which is likely to lead to market consolidation ...
(Date:3/22/2017)... ... ... Premier executive recruitment firm, Slone Partners, is proud to have been named ... , Hunt Scanlon Media is one of the most respected life science publications ... human capital sector. , “It is a great honor for Slone Partners to be ...
(Date:3/22/2017)... ... March 21, 2017 , ... The Conference Forum has announced the launch of ... on May 10-11, 2017, at the Colonnade Hotel in Boston, MA. The CMO Summit ... peer-to-peer learning, benchmarking and support. , “The Chief Medical Officer faces a unique set ...
(Date:3/22/2017)... HACKENSACK, N.J. and PETACH TIKVAH, ... Therapeutics Inc. (NASDAQ: BCLI), a leading developer of adult ... Chaim Lebovits , Chief Executive Officer, will provide ... at Sachs Associates 2 nd Annual Neuroscience Biopartnering ... at the New York Academy of Sciences. ...
Breaking Biology Technology: