Mouse Anti-ZFHX4 Polyclonal Antibody, Unconjugated from Abnova Corporation

3'-O-Methylguanosine 5'-Triphosphate, Sodium, 1 umol. Category: Nucleotides & Enzymes & Biochemicals, Nucleotides, Additional Nucleotide Products....

Recombinant Viral CCI/Fc Chimera, CF...

... ml. Improves reproducibility and quality ... streaking.Eliminates extra spots caused by ... throughout entire 2-D runs, ensuring ... for both analytical and preparative ...

LIVE/DEAD® Cell-Mediated Cytotoxicity Kit *for animal cells* *2000 assays*...

Biology Products:

3-O-Methylguanosine 5-Triphosphate, Sodium from GE Healthcare, formerly Amersham Biosciences Viral CCI, Unconjugated, Fc Chimera from R&D Systems DeStreak Reagent from GE Healthcare, formerly Amersham Biosciences Cytotoxicity Fluorometric (green / red) Assay Kit, LIVE/DEAD® from Molecular Probes (Invitrogen)

(Date:5/19/2013)... of electricity-producing bacteria that can grow using hydrogen gas ... its sole source of carbon. Researchers at the ... 113th General Meeting of the American Society for Microbiology. ... solely on hydrogen," says Amit Kumar, a researcher on ... of the Lovley Lab Group at the university. , ...

(Date:5/18/2013)... increasing number of U.S. children are experiencing gastrointestinal ... research presented at Digestive Disease Week (DDW). ... the Cleveland Clinic Children,s Hospital found that obese ... compared to their lean counterparts. The pattern showed ... be correlated to potential complications associated with obesity, ...

(Date:5/17/2013)... proteins in the brain responsible for protecting nerve cells ... increase cell survival. , The discovery, made by researchers ... the EMBO journal with additional comment in ... stroke and other brain diseases. , The research builds ... protein, known as SUMO, responsible for controlling the chemical ...

Breaking Biology News(10 mins):New research identifies risks, interventions for children's GI health 2 New research identifies risks, interventions for children's GI health 3 SUMO wrestling cells reveal new protective mechanism target for stroke 2

[0] Bacteria use hydrogen, carbon dioxide to produce electricity [0] New research identifies risks, interventions for children's GI health [0] SUMO wrestling cells reveal new protective mechanism target for stroke

... Addition to SAFsolution Product Family Simplifies the Addition ... Biometric Security to Thin-Client Identity Management., ... the,release of SAFsolution(R) Enterprise Citrix Web Authenticator, the ... security,solutions. SAFsolution Enterprise Citrix Web Authenticator takes the,standard ...

... announced they have discovered a previously unknown population of ... most endangered cat species, said World Wildlife Fund today. ... said Luis Suarez, head of WWFs Species Program in ... the Iberian lynx from imminent extinction. It appears ...

... The coal tit appears to live a strictly ... That,s only a facade. This indigenous songbird is among the ... at the University of Bonn shows. For this they have ... their young. In this way they were able to identify ...

Cached Biology News:IdentiPHI Introduces Biometric Authentication Solution for Citrix Web Interface Environments 2 IdentiPHI Introduces Biometric Authentication Solution for Citrix Web Interface Environments 3 Age increases chance of success as two-timer 2 Age increases chance of success as two-timer 3

IdentiPHI Introduces Biometric Authentication Solution for Citrix Web Interface Environments New population of Iberian lynx raises hope, says World Wildlife Fund Age increases chance of success as two-timer

(Date:5/17/2013)... , May 17, 2013 /PRNewswire-iReach/ -- Aridis is ... reached with Switzerland -based Kenta ... human monoclonal antibody (mAb) products, and technologies. This ... products for treatment of infections by common pathogens ... aureus , Pseudomonas aeruginosa , Acinetobacter ...

(Date:5/17/2013)... The paradigm of ‘one drug, one target’ ... help predict the adverse and therapeutic effects of a ... Computational Biology at the Genomics Laboratory, Covance, will discuss ... genomics when used as part of the QC process. ... sets to identify key clinical targets even in complex ...

(Date:5/17/2013)... May 17, 2013 IAC Industries wants to ... start up laboratory needing to set up and furnish a ... a larger facility within a year’s time. How does a ... the laboratory is temporary? What is efficient and cost-effective? ... workstations from IAC Industries. The planners at DisperSol determined that ...

(Date:5/16/2013)... ISPE announced today that ... the newly created position of Vice President of ... be responsible for stimulating ISPE’s revenue growth by ... Society’s Member-led and staff-driven business model, initiating integrated ... membership and product marketing. , “Barbara joins ISPE ...

Breaking Biology Technology:Aridis Pharmaceuticals Announces Acquisition of Monoclonal Antibody Products and Technologies From Kenta Biotech 2 Aridis Pharmaceuticals Announces Acquisition of Monoclonal Antibody Products and Technologies From Kenta Biotech 3 New Downloadable Success Story: “How To Outfit a Dynamic Lab in Flux” 2 ISPE Names Barbara A. Myers, CAE, as Vice President of Professional Development 2

[0] Aridis Pharmaceuticals Announces Acquisition of Monoclonal Antibody Products and Technologies From Kenta Biotech [0] Computational Analysis in Clinical and Preclinical Decision-Making, new webinar hosted by Xtalks [0] New Downloadable Success Story: “How To Outfit a Dynamic Lab in Flux”[0] ISPE Names Barbara A. Myers, CAE, as Vice President of Professional Development

Products	Mouse Anti-ZFHX4 Polyclonal Antibody, Unconjugated from Abnova Corporation
Company	Abnova Corporation
Item	Mouse Anti-ZFHX4 Polyclonal Antibody, Unconjugated
Price
Description	Mouse polyclonal antibody raised against a partial recombinant ZFHX4. Immunogen: ZFHX4 (NP_078997, 2 a.a. ~ 94 a.a) partial recombinant protein with GST tag. Accession Number: NM_024721 Protein Sequence: ETCDSPPISRQENGQSTSKLCGTTQLDNEVPEKVAGMEPDRENSSTDDNLKTDERKSEALLGFSVENAAATQVTSAKEIPCNECATSFPSLQ*
Info	Abnova Corporation Abnova Corporation (HQ) 9th Fl., No. 108, Jhouzih St. Neihu District, Taipei 114 Taiwan R.O.C. Tel: +886-2-8751-1888 Fax: +886-2-8751-1166 Abnova GmbH Boxbergring 107 69126 Heidelberg Germany Tel: +49 6221 3632226 Fax: +49 6221 825878 Customer Service: +886-2-8751-1888 Fax Number: +886-2-8751-1166 Web Site: http://www.abnova.com.tw