Navigation Links
Mouse Anti-ZFHX4 Polyclonal Antibody, Unconjugated from Abnova Corporation

ProductsMouse Anti-ZFHX4 Polyclonal Antibody, Unconjugated from Abnova Corporation
Company Abnova Corporation
Item Mouse Anti-ZFHX4 Polyclonal Antibody, Unconjugated
Price 
Description Mouse polyclonal antibody raised against a partial recombinant ZFHX4.
Immunogen: ZFHX4 (NP_078997, 2 a.a. ~ 94 a.a) partial recombinant protein with GST tag.
Accession Number: NM_024721
Protein Sequence: ETCDSPPISRQENGQSTSKLCGTTQLDNEVPEKVAGMEPDRENSSTDDNLKTDERKSEALLGFSVENAAATQVTSAKEIPCNECATSFPSLQ*
Info Abnova CorporationAbnova Corporation
Abnova Corporation (HQ)
9th Fl., No. 108, Jhouzih St.
Neihu District, Taipei
114 Taiwan R.O.C.
Tel: +886-2-8751-1888
Fax: +886-2-8751-1166

Abnova GmbH
Boxbergring 107
69126 Heidelberg
Germany
Tel: +49 6221 3632226
Fax: +49 6221 825878

Customer Service: +886-2-8751-1888
Fax Number: +886-2-8751-1166
Web Site: http://www.abnova.com.tw
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Mouse Anti-Amodiaquine Monoclonal Antibody, Unconjugated, Clone 6D10 from AntibodyShop A/S
2. Mouse Anti-Protein S Monoclonal Antibody, Unconjugated, Clone HYB 232-02 from Abcam
3. Mouse Anti-Mouse Glutathione S-transferase M1 (GSTM1) Monoclonal Antibody, Unconjugated from Lifespan Biosciences
4. Mouse Anti-Human S-100 alpha/beta chain Monoclonal Antibody, Unconjugated, Clone 8B10 from Santa Cruz Biotechnology, Inc.
5. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Testis from OriGene Technologies
6. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Brain (adult) from OriGene Technologies
7. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (12.5 - day) from OriGene Technologies
8. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (19 - day) from OriGene Technologies
9. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Thymus from OriGene Technologies
10. Mouse Anti-Human Complement factor B Monoclonal Antibody, Unconjugated, Clone 9B6 from AntibodyShop A/S
11. Mouse Anti-Human Choriongonadotropin (hCG) Monoclonal Antibody, Unconjugated, Clone 5F10 from AntibodyShop A/S
(Date:7/30/2014)... black truffle uses reversible epigenetic processes to regulate its ... ,methylome, - a picture of the genome regulation taking ... access journal Genome Biology and illustrates how ... and ,jumping genes,. The authors say this may shed ... controlled. , Black truffles (Tuber melanosporum), also known as ...
(Date:7/30/2014)... protected and tended her eggs until they hatched 4.5 ... 2014 in the open-access journal PLOS ONE ... and colleagues. , Octopuses typically have a single reproductive ... take care of their fertilized eggs until they hatch. ... to 3 months, but little is known about the ...
(Date:7/30/2014)... effects of climate change on the world,s animal ... factors, according to a new paper by a ... of Queensland, and other organizations. The authors claim ... the point when it comes to climate change. ... scientists focus on the "direct" threats of changing ...
Breaking Biology News(10 mins):How black truffles deal with the jumpers in their genome 2Deep-sea octopus has longest-known egg-brooding period 2Conservation scientists asking wrong questions on climate change impacts on wildlife 2
... and spend enormous resources on the conservation of endangered ... One big problem is international legislation and the need ... networks. Zoo resources can be spent much more effectively, ... animal collections across the world,s zoos. Many zoos ...
... and, in most cases, they have evolved a "circadian clock". ... has been shown to have important metabolic consequences for the ... on health; for example lack of sleep is linked with ... the ability to control body weight. Scientists from the ...
... Cell Research (ISSCR) has announced the following 2014 award ... Annual Meeting in Vancouver, taking place June 18-21, 2014: ... Research UK Gurdon Institute, for the McEwen Award for ... Yale Stem Cell Center, for the ISSCR-BD Biosciences Outstanding ...
Cached Biology News:Scientists warn: Conservation work in zoos is too random 2Scientists warn: Conservation work in zoos is too random 3The internal clock and feeding rhythm set the pace of the liver 2The International Society for Stem Cell Research announces its 2014 award recipients 2The International Society for Stem Cell Research announces its 2014 award recipients 3
(Date:7/31/2014)... July 31, 2014 Boston’s Adult Stem ... flush with innovative adult stem cell biotechnologies. Currently ... and has three additional patent applications currently under examination ... patented inventions address two of the most vexing problems ... Adult stem cells are difficult to identify; and ...
(Date:7/30/2014)... July 30, 2014 Regulus Therapeutics Inc ... leading the discovery and development of innovative medicines targeting ... and highlights for the quarter ended June 30, 2014 ... markets close. Regulus will host a ... at 5:00 pm Eastern Daylight Time to discuss its ...
(Date:7/30/2014)... 30, 2014 W. R. Grace ... of the REVELERIS® Prep purification system , ... chromatographers, and other researchers to perform both flash ... unit. , With the REVELERIS® Prep purification system, ... chromatography modes with a simple touch of the ...
(Date:7/30/2014)... A study presented at the 2014 ... of CSL Behring,s C1 Inhibitor (C1-INH) concentrate in ... sensitized patients. C1-INH is a human protein and ... The study shows that post-transplant treatment with ... of complement components 3 and 4, suggesting that ...
Breaking Biology Technology:The Adult Stem Cell Technology Center, LLC Launches A Marketing Campaign To License Adult Stem Cell Biotechnologies 2The Adult Stem Cell Technology Center, LLC Launches A Marketing Campaign To License Adult Stem Cell Biotechnologies 3Regulus Announces Timing for Second Quarter 2014 Financial Results Webcast and Conference Call 2Regulus Announces Timing for Second Quarter 2014 Financial Results Webcast and Conference Call 3Grace Launches New REVELERIS® Prep Purification System 2Study Suggests C1-INH May Aid in Prevention of Antibody-Mediated Rejection Following Kidney Transplant 2Study Suggests C1-INH May Aid in Prevention of Antibody-Mediated Rejection Following Kidney Transplant 3