Navigation Links
Mouse Anti-ZFHX4 Polyclonal Antibody, Unconjugated from Abnova Corporation

ProductsMouse Anti-ZFHX4 Polyclonal Antibody, Unconjugated from Abnova Corporation
Company Abnova Corporation
Item Mouse Anti-ZFHX4 Polyclonal Antibody, Unconjugated
Price 
Description Mouse polyclonal antibody raised against a partial recombinant ZFHX4.
Immunogen: ZFHX4 (NP_078997, 2 a.a. ~ 94 a.a) partial recombinant protein with GST tag.
Accession Number: NM_024721
Protein Sequence: ETCDSPPISRQENGQSTSKLCGTTQLDNEVPEKVAGMEPDRENSSTDDNLKTDERKSEALLGFSVENAAATQVTSAKEIPCNECATSFPSLQ*
Info Abnova CorporationAbnova Corporation
Abnova Corporation (HQ)
9th Fl., No. 108, Jhouzih St.
Neihu District, Taipei
114 Taiwan R.O.C.
Tel: +886-2-8751-1888
Fax: +886-2-8751-1166

Abnova GmbH
Boxbergring 107
69126 Heidelberg
Germany
Tel: +49 6221 3632226
Fax: +49 6221 825878

Customer Service: +886-2-8751-1888
Fax Number: +886-2-8751-1166
Web Site: http://www.abnova.com.tw
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Mouse Anti-Amodiaquine Monoclonal Antibody, Unconjugated, Clone 6D10 from AntibodyShop A/S
2. Mouse Anti-Protein S Monoclonal Antibody, Unconjugated, Clone HYB 232-02 from Abcam
3. Mouse Anti-Mouse Glutathione S-transferase M1 (GSTM1) Monoclonal Antibody, Unconjugated from Lifespan Biosciences
4. Mouse Anti-Human S-100 alpha/beta chain Monoclonal Antibody, Unconjugated, Clone 8B10 from Santa Cruz Biotechnology, Inc.
5. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Testis from OriGene Technologies
6. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Brain (adult) from OriGene Technologies
7. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (12.5 - day) from OriGene Technologies
8. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (19 - day) from OriGene Technologies
9. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Thymus from OriGene Technologies
10. Mouse Anti-Human Complement factor B Monoclonal Antibody, Unconjugated, Clone 9B6 from AntibodyShop A/S
11. Mouse Anti-Human Choriongonadotropin (hCG) Monoclonal Antibody, Unconjugated, Clone 5F10 from AntibodyShop A/S
5X StabilCoat Immunoassay Stabilizer is a 5X concentrate solution of StabilCoat Immunoassay Stabilizer. The shelf-life of 5X StabilCoat Immunoassay Stabilizer is 2 years when stored at 4C. Product ...
Mouse monoclonal antibody to PARK2 - Parkinson disease (autosomal recessive, juvenile) 2, parkin...
... factors for assays of mouse hematopoietic progenitors ... liver. Suitable for the growth of ... added to methylcellulose at a final concentration ... Will also support growth of mouse IL-3 ...
Mouse monoclonal antibody to FMN2 - formin 2...
Biology Products:
(Date:2/13/2017)... WASHINGTON , Feb. 13, 2017 Former ... U.S. Senate Judiciary Committee, Janice Kephart of ... regarding President Donald Trump,s "Executive Order: Protecting ... States" (Jan. 27, 2017):  "As President Trump,s ... 9th Circuit has now essentially banned the travel ban, ...
(Date:2/8/2017)... AWRE ), a leading supplier of biometrics software ... year ended December 31, 2016. Revenue for ... $6.9 million in the same quarter last year. Operating income ... to $2.6 million in the fourth quarter of 2015. Net ... or $0.02 per diluted share, which compares to $1.8 million, ...
(Date:2/7/2017)... Minn. , Feb. 7, 2017   MedNet ... supports the entire spectrum of clinical research, is pleased ... iMedNet , its innovative, highly flexible and award ... iMedNet customers. iMedNet is a proven ... provides Electronic Data Capture (EDC), but also delivers an ...
Breaking Biology News(10 mins):
(Date:2/22/2017)... ... February 22, 2017 , ... ... development of precision treatments for neurodegenerative diseases, today announced it has issued a ... approach.” This is one of a series of commentaries from ProMIS’s scientific team ...
(Date:2/22/2017)... , Feb 22, 2017 Dublin ... the "Global Biological Crop Protection (Bio-Pesticide) Market-By Type, By Application, ... report to their offering. ... Global Biological Crop Protection Market is forecasted to ... The strong growth in biopesticide or biological crop protection market is ...
(Date:2/22/2017)... ... February 22, 2017 , ... NDA Partners ... MD former Acting Deputy Director in the FDA CDRH Division of Cardiovascular, Respiratory, ... joined the company as an Expert Consultant. , In Dr. Spyker’s accomplished career, ...
(Date:2/22/2017)... N.C., Feb. 22, 2017  United Therapeutics Corporation (NASDAQ: ... results for the fourth quarter and year ended ... results reflect continued growth as net revenues reached ... Martine Rothblatt, Ph.D., United Therapeutics, Chairman and Chief ... to develop and advance our growing product pipeline, ...
Breaking Biology Technology: