Navigation Links
Mouse Anti-ZFHX4 Polyclonal Antibody, Unconjugated from Abnova Corporation

ProductsMouse Anti-ZFHX4 Polyclonal Antibody, Unconjugated from Abnova Corporation
Company Abnova Corporation
Item Mouse Anti-ZFHX4 Polyclonal Antibody, Unconjugated
Price 
Description Mouse polyclonal antibody raised against a partial recombinant ZFHX4.
Immunogen: ZFHX4 (NP_078997, 2 a.a. ~ 94 a.a) partial recombinant protein with GST tag.
Accession Number: NM_024721
Protein Sequence: ETCDSPPISRQENGQSTSKLCGTTQLDNEVPEKVAGMEPDRENSSTDDNLKTDERKSEALLGFSVENAAATQVTSAKEIPCNECATSFPSLQ*
Info Abnova CorporationAbnova Corporation
Abnova Corporation (HQ)
9th Fl., No. 108, Jhouzih St.
Neihu District, Taipei
114 Taiwan R.O.C.
Tel: +886-2-8751-1888
Fax: +886-2-8751-1166

Abnova GmbH
Boxbergring 107
69126 Heidelberg
Germany
Tel: +49 6221 3632226
Fax: +49 6221 825878

Customer Service: +886-2-8751-1888
Fax Number: +886-2-8751-1166
Web Site: http://www.abnova.com.tw
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Mouse Anti-Amodiaquine Monoclonal Antibody, Unconjugated, Clone 6D10 from AntibodyShop A/S
2. Mouse Anti-Protein S Monoclonal Antibody, Unconjugated, Clone HYB 232-02 from Abcam
3. Mouse Anti-Mouse Glutathione S-transferase M1 (GSTM1) Monoclonal Antibody, Unconjugated from Lifespan Biosciences
4. Mouse Anti-Human S-100 alpha/beta chain Monoclonal Antibody, Unconjugated, Clone 8B10 from Santa Cruz Biotechnology, Inc.
5. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Testis from OriGene Technologies
6. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Brain (adult) from OriGene Technologies
7. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (12.5 - day) from OriGene Technologies
8. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (19 - day) from OriGene Technologies
9. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Thymus from OriGene Technologies
10. Mouse Anti-Human Complement factor B Monoclonal Antibody, Unconjugated, Clone 9B6 from AntibodyShop A/S
11. Mouse Anti-Human Choriongonadotropin (hCG) Monoclonal Antibody, Unconjugated, Clone 5F10 from AntibodyShop A/S
The FliTrx Panning Kit is designed to simplify panning for protein-protein interactions with the FliTrx Random Peptide Display Library or the pFliTrx Peptide Display Vector....
...
... Quality ISO 9001:2000 Certified USDA ... Precedures Validated, SOP's Training AALAS ... for All Procedures GLP Documentation Upon Request ... stop shopping point for all your custom ...
... Modules Highly efficient ... cloning into advanced λ ... For flexibility ... Systems, the modules of ...
Biology Products:
(Date:1/25/2016)... , Jan. 25, 2016  Glencoe Software, the ... pharma and publication industries, will provide the data management ... Centre (NPSC). ... Phenotypic analysis measures ... whole organisms, allowing comparisons between states such as health ...
(Date:1/20/2016)... --  MedNet Solutions , an innovative SaaS-based eClinical technology ... is pleased to announce the attainment of record-setting corporate ... of the company,s laser focus on (and growing international ... comprehensive, easy-to-use and highly affordable cloud-based technology platform. ... growth achievements in 2015 include: , Record ...
(Date:1/13/2016)... 2016 http://www.researchandmarkets.com/research/7h6hnn/india_biometrics ... the  "India Biometrics Authentication & Identification ...  report to their offering.  ... the addition of the  "India Biometrics ... & Forecast (2015-2020)"  report to ...
Breaking Biology News(10 mins):
(Date:2/6/2016)... Virginia (PRWEB) , ... February 06, 2016 , ... ... E-mail: amitchell(at)cee(dot)org , The Center for Excellence in Education Sponsors Teacher Training ... VA – February 4, 2016 – The Center for Excellence in Education (CEE) ...
(Date:2/5/2016)... Feb. 5, 2016  In the pharmaceutical industry the ... host of launch activities including the identification and engagement ... activity is especially high in the oncology therapeutic area ... Practices and the Role of Medical Affairs in Oncology ... on oncology therapies find better ways to utilize medical ...
(Date:2/5/2016)... , February 5, 2016 ... a biotechnology company focused on developing products for Regenerative ... requested Rare Pediatric Disease Designation (RPDD) from the US ... (RP) with MANF. MANF was previously granted orphan drug ... --> Amarantus BioScience Holdings, Inc. ...
(Date:2/4/2016)... ... February 04, 2016 , ... ... compliance training, today announced an interactive FDA compliance training course, ... (Regulatory Affairs Professional Society) accredited interactive course on Morf Playbook—now conveniently available on ...
Breaking Biology Technology: