Navigation Links
Mouse Anti-ZFHX4 Polyclonal Antibody, Unconjugated from Abnova Corporation

ProductsMouse Anti-ZFHX4 Polyclonal Antibody, Unconjugated from Abnova Corporation
Company Abnova Corporation
Item Mouse Anti-ZFHX4 Polyclonal Antibody, Unconjugated
Price 
Description Mouse polyclonal antibody raised against a partial recombinant ZFHX4.
Immunogen: ZFHX4 (NP_078997, 2 a.a. ~ 94 a.a) partial recombinant protein with GST tag.
Accession Number: NM_024721
Protein Sequence: ETCDSPPISRQENGQSTSKLCGTTQLDNEVPEKVAGMEPDRENSSTDDNLKTDERKSEALLGFSVENAAATQVTSAKEIPCNECATSFPSLQ*
Info Abnova CorporationAbnova Corporation
Abnova Corporation (HQ)
9th Fl., No. 108, Jhouzih St.
Neihu District, Taipei
114 Taiwan R.O.C.
Tel: +886-2-8751-1888
Fax: +886-2-8751-1166

Abnova GmbH
Boxbergring 107
69126 Heidelberg
Germany
Tel: +49 6221 3632226
Fax: +49 6221 825878

Customer Service: +886-2-8751-1888
Fax Number: +886-2-8751-1166
Web Site: http://www.abnova.com.tw
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Mouse Anti-Amodiaquine Monoclonal Antibody, Unconjugated, Clone 6D10 from AntibodyShop A/S
2. Mouse Anti-Protein S Monoclonal Antibody, Unconjugated, Clone HYB 232-02 from Abcam
3. Mouse Anti-Mouse Glutathione S-transferase M1 (GSTM1) Monoclonal Antibody, Unconjugated from Lifespan Biosciences
4. Mouse Anti-Human S-100 alpha/beta chain Monoclonal Antibody, Unconjugated, Clone 8B10 from Santa Cruz Biotechnology, Inc.
5. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Testis from OriGene Technologies
6. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Brain (adult) from OriGene Technologies
7. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (12.5 - day) from OriGene Technologies
8. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (19 - day) from OriGene Technologies
9. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Thymus from OriGene Technologies
10. Mouse Anti-Human Complement factor B Monoclonal Antibody, Unconjugated, Clone 9B6 from AntibodyShop A/S
11. Mouse Anti-Human Choriongonadotropin (hCG) Monoclonal Antibody, Unconjugated, Clone 5F10 from AntibodyShop A/S
(Date:3/22/2016)... March 22, 2016 ... Sensors Market for Consumer Industry by Type (Image, ... Application (Communication & IT, Entertainment, Home Appliances, ... Forecast to 2022", published by MarketsandMarkets, the ... to reach USD 26.76 Billion by 2022, ...
(Date:3/15/2016)... 2016 --> --> ... Market Research "Digital Door Lock Systems Market - Global Industry ... the global digital door lock systems market in terms of ... is forecast to grow at a CAGR of 31.8% during ... medium enterprises (MSMEs) across the world and high industrial activity ...
(Date:3/11/2016)... --> --> ... Recognition Market by Technology (Pattern Recognition), by Component (Hardware, ... Type (On-Premises and Cloud), by Industry Vertical and by ... the global market is expected to grow from USD ... 2020, at a CAGR of 19.1%. , ...
Breaking Biology News(10 mins):
(Date:4/27/2016)... and RESEARCH TRIANGLE PARK, N.C. , ... UTHR ) announced today that Martine Rothblatt ... Therapeutics will provide an overview and update on the ... Annual Health Care Conference. The presentation will ... a.m. Eastern Time, and can be accessed via a ...
(Date:4/27/2016)... (PRWEB) , ... April 27, 2016 , ... ... Lamka, PhD to its Scientific Advisory Board. Dr. Lamka will assist PathSensors in ... pathogen detection. , PathSensors deploys the CANARY® test platform for the detection ...
(Date:4/27/2016)... ... , ... Global Stem Cells Group and the University of Santiago ... and development initiatives for potential stem cell protocol management for 2016 – 2020. ... began meeting to establish a working agenda and foster initiatives to promote stem cell ...
(Date:4/26/2016)... ... April 27, 2016 , ... ... Rothgerber Christie LLP as an associate in the firm’s Intellectual Property practice group. ... mechanical and electromechanical patent applications. He has an electrical engineering and computer engineering ...
Breaking Biology Technology: