Navigation Links
Mouse Anti-ZFHX4 Polyclonal Antibody, Unconjugated from Abnova Corporation

ProductsMouse Anti-ZFHX4 Polyclonal Antibody, Unconjugated from Abnova Corporation
Company Abnova Corporation
Item Mouse Anti-ZFHX4 Polyclonal Antibody, Unconjugated
Price 
Description Mouse polyclonal antibody raised against a partial recombinant ZFHX4.
Immunogen: ZFHX4 (NP_078997, 2 a.a. ~ 94 a.a) partial recombinant protein with GST tag.
Accession Number: NM_024721
Protein Sequence: ETCDSPPISRQENGQSTSKLCGTTQLDNEVPEKVAGMEPDRENSSTDDNLKTDERKSEALLGFSVENAAATQVTSAKEIPCNECATSFPSLQ*
Info Abnova CorporationAbnova Corporation
Abnova Corporation (HQ)
9th Fl., No. 108, Jhouzih St.
Neihu District, Taipei
114 Taiwan R.O.C.
Tel: +886-2-8751-1888
Fax: +886-2-8751-1166

Abnova GmbH
Boxbergring 107
69126 Heidelberg
Germany
Tel: +49 6221 3632226
Fax: +49 6221 825878

Customer Service: +886-2-8751-1888
Fax Number: +886-2-8751-1166
Web Site: http://www.abnova.com.tw
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Mouse Anti-Amodiaquine Monoclonal Antibody, Unconjugated, Clone 6D10 from AntibodyShop A/S
2. Mouse Anti-Protein S Monoclonal Antibody, Unconjugated, Clone HYB 232-02 from Abcam
3. Mouse Anti-Mouse Glutathione S-transferase M1 (GSTM1) Monoclonal Antibody, Unconjugated from Lifespan Biosciences
4. Mouse Anti-Human S-100 alpha/beta chain Monoclonal Antibody, Unconjugated, Clone 8B10 from Santa Cruz Biotechnology, Inc.
5. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Testis from OriGene Technologies
6. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Brain (adult) from OriGene Technologies
7. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (12.5 - day) from OriGene Technologies
8. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (19 - day) from OriGene Technologies
9. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Thymus from OriGene Technologies
10. Mouse Anti-Human Complement factor B Monoclonal Antibody, Unconjugated, Clone 9B6 from AntibodyShop A/S
11. Mouse Anti-Human Choriongonadotropin (hCG) Monoclonal Antibody, Unconjugated, Clone 5F10 from AntibodyShop A/S
... Detection Kit,provides a fast, convenient and ... pyrophosphate (PPi ) produced,by a number ... and,RNA polymerizations, cyclic AMP formation by ... activation of fatty acids to,form their ...
... high PCR specificity *High PCR specificity ... enzyme with unique QIAGEN PCR Buffer ... provided by the stringent built-in hot ... Master Mix and simple reaction setup ...
Request Info...
... AC is the easiest to program ... provided with liquid level sensors for ... integrated orbital shaker and automatic rinsing ... performance. The big bottle model is ...
Biology Products:
(Date:8/26/2015)... The report "Multi-Factor Authentication (MFA) Market ... (Travel & Immigration, Government, Banking, Defense, Commercial Security, Consumer ... published by MarketsandMarkets, Multi-Factor Authentication Market is expected to ... CAGR of 17.7% between 2015 and 2020. ... spread through 169 P ages and ...
(Date:8/20/2015)... Aug. 20, 2015   Sensory, Inc ., ... the user experience and security of consumer electronics ... announced that its TrulySecure™ is the ... to be FIDO Certified™. The FIDO ... with the FIDO UAF (Universal Authentication Framework) 1.0 ...
(Date:8/17/2015)... , Aug. 17, 2015  NXT-ID, Inc. (NASDAQ: ... authentication company focused on the growing mobile commerce market ... new sales campaign for Q4 2015. The new marketing ... team consisting of Amplitude Marketing Group ( http://amplitudemarketing.com/ ) ... Group is a leader in retail driven marketing and ...
Breaking Biology News(10 mins):Multi-Factor Authentication Market Worth 9.60 Billion USD by 2020 2Multi-Factor Authentication Market Worth 9.60 Billion USD by 2020 3Multi-Factor Authentication Market Worth 9.60 Billion USD by 2020 4Multi-Factor Authentication Market Worth 9.60 Billion USD by 2020 5TrulySecure From Sensory Becomes First Face and Voice Biometrics Technology to be FIDO UAF Certified 2TrulySecure From Sensory Becomes First Face and Voice Biometrics Technology to be FIDO UAF Certified 3TrulySecure From Sensory Becomes First Face and Voice Biometrics Technology to be FIDO UAF Certified 4TrulySecure From Sensory Becomes First Face and Voice Biometrics Technology to be FIDO UAF Certified 5NXT-ID, Inc. Launches Sales Campaign for Wocket Smart Wallet with Award Winning Marketing Team 2NXT-ID, Inc. Launches Sales Campaign for Wocket Smart Wallet with Award Winning Marketing Team 3
... 10, 2008; Saranac Lake, N.Y. -- Findings just published ... at the Trudeau Institute shed new light on how ... prompts specific influenza-fighting cells to the lung airways during ... responsible for hundreds of thousands of hospitalizations and as ...
... from the University of Copenhagen and the Biocentre at the ... part of the immune system,s key codes. The same ... autumn, and have now put together a comprehensive picture of ... outside our cells. According to the researchers this new ...
... the Earth, thriving by filling every nook and cranny ... arrived on the scene. Now, this ability of ... food sources may play a significant role in bailing ... the Biodesign Institute,s Bruce Rittmann, Rosa Krajmalnik-Brown, and Rolf ...
Cached Biology News:Mobilizing white blood cells to the lung: New discovery could lead to an improved influenza vaccine 2Can microorganisms be a solution to the world's energy problems? 2Can microorganisms be a solution to the world's energy problems? 3Can microorganisms be a solution to the world's energy problems? 4
(Date:8/26/2015)... -- The Diabetes Research Institute (DRI), a Center of ... of Medicine, announced today that the first patient ... first time a novel transplant technique for insulin-producing ... I/II study builds upon decades of progress in ... step toward the development of the DRI BioHub, ...
(Date:8/26/2015)... and BEIJING , August 26, 2015 ... Impressive Acheivements  DiaCardio wins 1 st place  ... The competition, led in Israel by venture ... startups from countries including the US, China , ... Latin America .  Impressive achievement for ...
(Date:8/26/2015)... 2015 Despite recent market ... optimism in biotech,s forecast is the recent run ... advancements.  Active biotechnology & healthcare companies with recent ... PBIO), Sequenom, Inc. (NASDAQ: SQNM ), Sarepta ... Corp. (NASDAQ: RPTP ) and EnteroMedics Inc. ...
(Date:8/25/2015)... 25, 2015   WuXi PharmaTech (Cayman) Inc. (NYSE: ... technology platform company serving the pharmaceutical, biotechnology, and medical ... Hong Kong Exchange Stock Code: 0950), a research-based biopharmaceutical ... with 20 years of operations in China ... signed an agreement whereby WuXi,s Laboratory Testing Division (LTD) ...
Breaking Biology Technology:Diabetes Research Institute Successfully Transplants First Patient In Pilot BioHub Trial 2Diabetes Research Institute Successfully Transplants First Patient In Pilot BioHub Trial 3Diabetes Research Institute Successfully Transplants First Patient In Pilot BioHub Trial 4Israeli Startup Takes First Place at Shengjing Global Innovation Awards 2015 2Israeli Startup Takes First Place at Shengjing Global Innovation Awards 2015 3Israeli Startup Takes First Place at Shengjing Global Innovation Awards 2015 4Israeli Startup Takes First Place at Shengjing Global Innovation Awards 2015 5Israeli Startup Takes First Place at Shengjing Global Innovation Awards 2015 6New Collaborations & Mergers For Research of Molecular Biomarkers in Human Diseases & Clinical Trials for Cancer Therapies Fueling Growth in Multi-Billion Dollar Life Sciences Market 2New Collaborations & Mergers For Research of Molecular Biomarkers in Human Diseases & Clinical Trials for Cancer Therapies Fueling Growth in Multi-Billion Dollar Life Sciences Market 3New Collaborations & Mergers For Research of Molecular Biomarkers in Human Diseases & Clinical Trials for Cancer Therapies Fueling Growth in Multi-Billion Dollar Life Sciences Market 4New Collaborations & Mergers For Research of Molecular Biomarkers in Human Diseases & Clinical Trials for Cancer Therapies Fueling Growth in Multi-Billion Dollar Life Sciences Market 5New Collaborations & Mergers For Research of Molecular Biomarkers in Human Diseases & Clinical Trials for Cancer Therapies Fueling Growth in Multi-Billion Dollar Life Sciences Market 6New Collaborations & Mergers For Research of Molecular Biomarkers in Human Diseases & Clinical Trials for Cancer Therapies Fueling Growth in Multi-Billion Dollar Life Sciences Market 7WuXi PharmaTech to Be Exclusive Supplier of Laboratory Testing Services to Lee's Pharm 2WuXi PharmaTech to Be Exclusive Supplier of Laboratory Testing Services to Lee's Pharm 3