Navigation Links
Mouse Anti-ZFHX4 Polyclonal Antibody, Unconjugated from Abnova Corporation

ProductsMouse Anti-ZFHX4 Polyclonal Antibody, Unconjugated from Abnova Corporation
Company Abnova Corporation
Item Mouse Anti-ZFHX4 Polyclonal Antibody, Unconjugated
Price 
Description Mouse polyclonal antibody raised against a partial recombinant ZFHX4.
Immunogen: ZFHX4 (NP_078997, 2 a.a. ~ 94 a.a) partial recombinant protein with GST tag.
Accession Number: NM_024721
Protein Sequence: ETCDSPPISRQENGQSTSKLCGTTQLDNEVPEKVAGMEPDRENSSTDDNLKTDERKSEALLGFSVENAAATQVTSAKEIPCNECATSFPSLQ*
Info Abnova CorporationAbnova Corporation
Abnova Corporation (HQ)
9th Fl., No. 108, Jhouzih St.
Neihu District, Taipei
114 Taiwan R.O.C.
Tel: +886-2-8751-1888
Fax: +886-2-8751-1166

Abnova GmbH
Boxbergring 107
69126 Heidelberg
Germany
Tel: +49 6221 3632226
Fax: +49 6221 825878

Customer Service: +886-2-8751-1888
Fax Number: +886-2-8751-1166
Web Site: http://www.abnova.com.tw
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Mouse Anti-Amodiaquine Monoclonal Antibody, Unconjugated, Clone 6D10 from AntibodyShop A/S
2. Mouse Anti-Protein S Monoclonal Antibody, Unconjugated, Clone HYB 232-02 from Abcam
3. Mouse Anti-Mouse Glutathione S-transferase M1 (GSTM1) Monoclonal Antibody, Unconjugated from Lifespan Biosciences
4. Mouse Anti-Human S-100 alpha/beta chain Monoclonal Antibody, Unconjugated, Clone 8B10 from Santa Cruz Biotechnology, Inc.
5. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Testis from OriGene Technologies
6. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Brain (adult) from OriGene Technologies
7. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (12.5 - day) from OriGene Technologies
8. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (19 - day) from OriGene Technologies
9. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Thymus from OriGene Technologies
10. Mouse Anti-Human Complement factor B Monoclonal Antibody, Unconjugated, Clone 9B6 from AntibodyShop A/S
11. Mouse Anti-Human Choriongonadotropin (hCG) Monoclonal Antibody, Unconjugated, Clone 5F10 from AntibodyShop A/S
... Kit is a 2-color staining method for ... to detect apoptotic cells by flow cytometry. ... required for measuring apoptosis in cells including ... reagent performance; washing, reaction and rinsing buffers ...
... a low melting point agarose used for ... strips in place for most applications. Bromophenol ... monitoring of electrophoresis runs. The solution is ... in 1x Tris, glycine, SDS, and 0.003% ...
The Trans-Blot Plus gel and cassette assembly tray is used to hold the Trans-Blot Plus gel holder cassette, buffer, and other materials for the gel and membrane sandwich during their assembly....
... mini IEF cell is an apparatus dedicated ... polyacrylamide or agarose slab gels. The cell ... electrodes, casting tray, 5 glass plates, 50 ... 5 sample templates, and instructions. Dimensions are ...
Biology Products:
(Date:4/26/2016)... , April 27, 2016 ... "Global Multi-modal Biometrics Market 2016-2020"  report to their ... , The analysts forecast the global ... of 15.49% during the period 2016-2020.  ... of sectors such as the healthcare, BFSI, transportation, ...
(Date:4/13/2016)... CHICAGO , April 13, 2016  IMPOWER physicians ... are setting a new clinical standard in telehealth ... By leveraging the higi platform, IMPOWER patients can ... weight, pulse and body mass index, and, when they ... quick and convenient visit to a local retail location ...
(Date:3/22/2016)... India , March 22, 2016 /PRNewswire/ ... market research report "Electronic Sensors Market for Consumer ... Proximity, & Others), Application (Communication & IT, ... Geography - Global Forecast to 2022", published ... industry is expected to reach USD 26.76 ...
Breaking Biology News(10 mins):
(Date:5/24/2016)... ... May 24, 2016 , ... Media Cybernetics, ... new Media Cybernetics corporate branding reflects a results-driven revitalization for a company with ... The re-branding components include a crisp, refreshed logo and a new web presence. ...
(Date:5/23/2016)... ... May 23, 2016 , ... PrecisionAg® Media has ... 2017 and Beyond. The paper outlines the key trends that are creating both ... “We’ve witnessed a lot of highs and lows as the precision agriculture market ...
(Date:5/23/2016)... , May 23, 2016 Oxitec CEO ... th at 10:15 a.m. ET before the United States ... genetically engineered mosquitos can play in controlling the spread of ... the Zika virus.      (Logo: http://photos.prnewswire.com/prnh/20150630/227348 ... mosquito with a self-limiting gene. Trials in Brazil ...
(Date:5/23/2016)... ... May 23, 2016 , ... RoviSys, a leading ... in Aurora, Ohio, has broken ground on a new building in Holly Springs, ... area, this new location solidifies a commitment to business in the region. The ...
Breaking Biology Technology: