Navigation Links
Mouse Anti-ZFHX4 Polyclonal Antibody, Unconjugated from Abnova Corporation

ProductsMouse Anti-ZFHX4 Polyclonal Antibody, Unconjugated from Abnova Corporation
Company Abnova Corporation
Item Mouse Anti-ZFHX4 Polyclonal Antibody, Unconjugated
Price 
Description Mouse polyclonal antibody raised against a partial recombinant ZFHX4.
Immunogen: ZFHX4 (NP_078997, 2 a.a. ~ 94 a.a) partial recombinant protein with GST tag.
Accession Number: NM_024721
Protein Sequence: ETCDSPPISRQENGQSTSKLCGTTQLDNEVPEKVAGMEPDRENSSTDDNLKTDERKSEALLGFSVENAAATQVTSAKEIPCNECATSFPSLQ*
Info Abnova CorporationAbnova Corporation
Abnova Corporation (HQ)
9th Fl., No. 108, Jhouzih St.
Neihu District, Taipei
114 Taiwan R.O.C.
Tel: +886-2-8751-1888
Fax: +886-2-8751-1166

Abnova GmbH
Boxbergring 107
69126 Heidelberg
Germany
Tel: +49 6221 3632226
Fax: +49 6221 825878

Customer Service: +886-2-8751-1888
Fax Number: +886-2-8751-1166
Web Site: http://www.abnova.com.tw
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Mouse Anti-Amodiaquine Monoclonal Antibody, Unconjugated, Clone 6D10 from AntibodyShop A/S
2. Mouse Anti-Protein S Monoclonal Antibody, Unconjugated, Clone HYB 232-02 from Abcam
3. Mouse Anti-Mouse Glutathione S-transferase M1 (GSTM1) Monoclonal Antibody, Unconjugated from Lifespan Biosciences
4. Mouse Anti-Human S-100 alpha/beta chain Monoclonal Antibody, Unconjugated, Clone 8B10 from Santa Cruz Biotechnology, Inc.
5. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Testis from OriGene Technologies
6. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Brain (adult) from OriGene Technologies
7. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (12.5 - day) from OriGene Technologies
8. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (19 - day) from OriGene Technologies
9. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Thymus from OriGene Technologies
10. Mouse Anti-Human Complement factor B Monoclonal Antibody, Unconjugated, Clone 9B6 from AntibodyShop A/S
11. Mouse Anti-Human Choriongonadotropin (hCG) Monoclonal Antibody, Unconjugated, Clone 5F10 from AntibodyShop A/S
Mouse Anti-Human QPRT Monoclonal Antibody, Unconjugated, Clone 5D11 from ABR-Affinity BioReagents
BD FACSArray bioanalyzer from BD Biosciences - Immunocytometry Systems
Agarose, Type C from Calbiochem
Chicken Anti-Human QPRT Polyclonal Antibody, Unconjugated from ProSci, Inc
Biology Products:
(Date:11/23/2009)... Mass. November 23, 2009 Applied mathematicians ...sta lancifolia ), a characteristic long leaf with ...pples along the edges. The simple cause of the lil...m bending during differential growthwas revealed b...am ribbons. , Haiyi Liang, a postdoctoral studen...
(Date:11/23/2009)... Current research suggests that a common oral bac...ated report by Nichols et al, "Unique Lipids from ...TLR2 Ligands Capable of Enhancing Autoimmunity," a... Journal of Pathology . , Multiple sclerosis (MS...rain and spinal cord, affects nearly 1 in 700 peop...
(Date:11/23/2009)...ovember 16, 2009 -- A USDOE and USDA study conclud...opland, and cropland pasture could be converted fr...sses, such as switchgrass, from which biomass coul...nomically viable production of a perennial grass m...omass are removed annually is expected to require ...
Breaking Biology News(10 mins):The cause behind the characteristic shape of a long leaf revealed 2Factors from common human bacteria may trigger multiple sclerosis 2Switchgrass produces biomass efficiently 2Sakayu Shimizu of Kyoto University recipient of 2009 Enzyme Engineering Award 9960 1Sakayu Shimizu of Kyoto University recipient of 2009 Enzyme Engineering Award 9960 2Regulatory role of key molecule discovered at Hebrew U 9958 1MedTrust Online Surpasses 5 000 Registered Users and Adds Dr Henry Friedman to Oncology Advisory Board 14120 1MedTrust Online Surpasses 5 000 Registered Users and Adds Dr Henry Friedman to Oncology Advisory Board 14120 2
...Federal scientists have developed a vaccine that p...us. They also have created a technique for identif... that could help contain future pandemic flu strai...say, to understanding and preventing the recurrenc... pandemic and to protecting against virulent flu s...
...Human rhinovirus (HRV), the leading cause of most ...nsplant patients, leading to progressive respirato...ere part of a group of 11 transplant patients who ...ion from HRV in both the upper and lower airways, ...only upper airway tissue. , The research appears i...
...A protein known to be a key component of the glue ...king them apart and promoting their movement when ... researchers at Mayo Clinic have found. , The stud...ournal of Cell Biology, helps illuminate the very ...cancer that makes the disease difficult to treat, ...
Other Biology News:Experimental vaccine protects mice against deadly 1918 flu virus 2Experimental vaccine protects mice against deadly 1918 flu virus 3Experimental vaccine protects mice against deadly 1918 flu virus 4Common cold virus leads to death in lung transplant patients 2Two-faced protein can stop metastasis or promote it, researchers say 2Two-faced protein can stop metastasis or promote it, researchers say 3
(Date:11/25/2009)..., MARKHAM,ON,Nov.25/PRNewswire/-Cytochromatod...dofDirectors.Dr.MoldtwillreplaceMr.UlrikSporkasthe...ofBoardmembersremainsunchangedatsixmembers. ,, ...ookforwardtobenefitingfromhisexperienceandguidance...ingCKD-focusedspecialtypharmaceuticalcompany,"stat...
(Date:11/25/2009)..., NEWYORK,Nov.25/PRNewswire/--Reportlinker.co...nitscatalogue: ,, BrazilBioethanolMarketAnalys...er.com/p0165503/Brazil-Bioethanol-Market-Analysis-...MarketAnalysisandForecaststo2013 ,, Summary ,...oftheglobalbioethanolmarketandtheBrazilbioethanolm...
(Date:11/24/2009)... This release is available in German . , W...tion cards: RFID tags (Radio Frequency Identificat...day life. They make it possible to label objects o...requency. The appropriate scanner can read and pro... can be affixed to goods under production conditio...
(Date:11/24/2009)... Ambassador to also Visit ...r 24, 2009 -- , , ,Who: David Appia, French Ambass...d CEO of the Invest in France Agency, , , , ,What... to discuss recent pro-business initiatives adopte...al and academic landscape for innovation and devel...
Breaking Biology Technology:Cytochroma Announces Appointment of Peter Moldt to Board of Directors 2Reportlinker Adds Brazil Bioethanol Market Analysis and Forecasts to 2013 2Reportlinker Adds Brazil Bioethanol Market Analysis and Forecasts to 2013 3Reportlinker Adds Brazil Bioethanol Market Analysis and Forecasts to 2013 4Reportlinker Adds Brazil Bioethanol Market Analysis and Forecasts to 2013 5Reportlinker Adds Brazil Bioethanol Market Analysis and Forecasts to 2013 6Reportlinker Adds Brazil Bioethanol Market Analysis and Forecasts to 2013 7Reportlinker Adds Brazil Bioethanol Market Analysis and Forecasts to 2013 8Reportlinker Adds Brazil Bioethanol Market Analysis and Forecasts to 2013 9Intelligence inside metal components 2