Navigation Links
Mouse Anti-XAGE2 Polyclonal Antibody, Unconjugated from Abnova Corporation

ProductsMouse Anti-XAGE2 Polyclonal Antibody, Unconjugated from Abnova Corporation
Company Abnova Corporation
Item Mouse Anti-XAGE2 Polyclonal Antibody, Unconjugated
Price 
Description Mouse polyclonal antibody raised against a partial recombinant XAGE2.
Immunogen: XAGE2 (NP_570133, 44 a.a. ~ 112 a.a) partial recombinant protein with GST tag.
Accession Number: NM_130777
Protein Sequence: RNPTPDQKREDDQGAAEIQVPDLEADLQELCQTKTGDGCEGGTDVKGKILPKAEHFKMPEAGEGKSQV*
Info Abnova CorporationAbnova Corporation
Abnova Corporation (HQ)
9th Fl., No. 108, Jhouzih St.
Neihu District, Taipei
114 Taiwan R.O.C.
Tel: +886-2-8751-1888
Fax: +886-2-8751-1166

Abnova GmbH
Boxbergring 107
69126 Heidelberg
Germany
Tel: +49 6221 3632226
Fax: +49 6221 825878

Customer Service: +886-2-8751-1888
Fax Number: +886-2-8751-1166
Web Site: http://www.abnova.com.tw
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Mouse Anti-Amodiaquine Monoclonal Antibody, Unconjugated, Clone 6D10 from AntibodyShop A/S
2. Mouse Anti-Protein S Monoclonal Antibody, Unconjugated, Clone HYB 232-02 from Abcam
3. Mouse Anti-Mouse Glutathione S-transferase M1 (GSTM1) Monoclonal Antibody, Unconjugated from Lifespan Biosciences
4. Mouse Anti-Human S-100 alpha/beta chain Monoclonal Antibody, Unconjugated, Clone 8B10 from Santa Cruz Biotechnology, Inc.
5. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Testis from OriGene Technologies
6. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Brain (adult) from OriGene Technologies
7. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (12.5 - day) from OriGene Technologies
8. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (19 - day) from OriGene Technologies
9. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Thymus from OriGene Technologies
10. Mouse Anti-Human Complement factor B Monoclonal Antibody, Unconjugated, Clone 9B6 from AntibodyShop A/S
11. Mouse Anti-Human Choriongonadotropin (hCG) Monoclonal Antibody, Unconjugated, Clone 5F10 from AntibodyShop A/S
RNase-Free DNase 50 l...
supplied with 10x reaction buffer...
... an endoribonuclease, the RNA strand of ... origin, e.g. that of phage FX174, ... x poly(dT). RNase H produces ribonucleotides ... no activity is detected with polyribonucleotides ...
Unit Definition: 1 U corresponds to the amount of enzyme which produces 1 mol protons per minute at pH 5.5 and 30C (peptin from citrus peel, Fluka-No. 76280, as substrate)...
Biology Products:
(Date:12/22/2014)... Dec. 22, 2014 Research and Markets ... the addition of the "The Global ... their offering. ... an overview of the global digital media ... control and monitor piracy by securely and ...
(Date:12/19/2014)... Dec. 18, 2014 Research and Markets ... "Micro Market Monitor: North America Perimeter Security Systems ... http://photos.prnewswire.com/prnh/20130307/600769 The North American ... CAGR of 3.6% from 2014 to 2019. Although the ... Canada is expected to grow ...
(Date:12/17/2014)... DUBLIN , Dec. 15, 2014 Research ... announced the addition of the "Samsung Galaxy ... Analysis" report to their offering. ... on a totally different sensing technology than the ... a fingerprint sensor in its product. ...
Breaking Biology News(10 mins):The Global Watermarking and Fingerprinting Markets 2Micro Market Monitor: North America Perimeter Security Systems Market (Intrusion Detection Sensor, Video Surveillance, Communication/Alarm and Notification, Access Control System) 2Micro Market Monitor: North America Perimeter Security Systems Market (Intrusion Detection Sensor, Video Surveillance, Communication/Alarm and Notification, Access Control System) 3Samsung Galaxy S5 - Home Button Synaptics Fingerprint Sensor Technology Analysis 2
... Mankind's closest living relatives-the world's apes, monkeys, lemurs ... some could soon disappear forever, according to a ... of IUCN-The World Conservation Union's Species Survival Commission ... collaboration with Conservation International (CI). , Primates in ...
... Human Genome Research Institute (NHGRI), one of the ... the Large-Scale Sequencing Research Network will begin sequencing ... a skate and several important insects, as part ... the human genome. , The National Advisory Council ...
... with HIV-1 engage a primitive defense mechanism that ... The research also reveals exactly how HIV-1 successfully ... cells. However, elucidation of the mechanism HIV-1 uses ... a potential vulnerability within the HIV-1 molecule. Identification ...
Cached Biology News:Primates on the brink 2Primates on the brink 3Primates on the brink 4NHGRI targets 12 more organisms for genome sequencing 2NHGRI targets 12 more organisms for genome sequencing 3NHGRI targets 12 more organisms for genome sequencing 4NHGRI targets 12 more organisms for genome sequencing 5Ancient immune defense mechanism is no match for HIV-1 2
(Date:12/24/2014)... 23, 2014 SoundConnect’s ... designed to introduce cutting edge communication technology, ... partners of platform upgrades. This webinar series ... users in their quest to leverage web ... According to SoundConnect’s Marketing Manager, Seanna Baumgartner, ...
(Date:12/24/2014)... (PRWEB) December 24, 2014 The report ... at 19.7% by 2019. It also provides a carefully ... strategies and challenges for the market. , Full Copy ... the report, the global market for cell expansion will ... future. It expects this growth to be driven by ...
(Date:12/24/2014)... Sigma-Aldrich Corporation (NASDAQ: SIAL ... the Hart-Scott-Rodino Antitrust Improvements Act (HSR Act) in ... 2014, thereby completing the U.S. HSR Act antitrust ... the Company by Merck KGaA, Darmstadt, Germany.  ... to closing the transaction, which remains subject to ...
(Date:12/22/2014)... 22, 2014 /PRNewswire/ - RepliCel Life Sciences Inc. (OTCQB: ... focused on the development of autologous cell therapies, announced ... University of Calgary in conjunction with co-authors from Kyoto ... validates the company,s ongoing clinical research using dermal sheath ... baldness. The paper entitled " Hair Follicle ...
Breaking Biology Technology:SoundConnect Launches Leading Edge Business Communications Webinar Series 2SoundConnect Launches Leading Edge Business Communications Webinar Series 3The Cell Expansion Market is Expected to Reach $14.8 billion by 2019 - New Research Report by MarketsandMarkets 2The Cell Expansion Market is Expected to Reach $14.8 billion by 2019 - New Research Report by MarketsandMarkets 3Acquisition of Sigma-Aldrich by Merck KGaA, Darmstadt, Germany, Receives U.S. Antitrust Clearance 2Acquisition of Sigma-Aldrich by Merck KGaA, Darmstadt, Germany, Receives U.S. Antitrust Clearance 3Newly Released Peer-Reviewed Publication Further Validates RepliCel's Use of Dermal Sheath Cup Cells to Treat Pattern Baldness 2Newly Released Peer-Reviewed Publication Further Validates RepliCel's Use of Dermal Sheath Cup Cells to Treat Pattern Baldness 3Newly Released Peer-Reviewed Publication Further Validates RepliCel's Use of Dermal Sheath Cup Cells to Treat Pattern Baldness 4Newly Released Peer-Reviewed Publication Further Validates RepliCel's Use of Dermal Sheath Cup Cells to Treat Pattern Baldness 5