Navigation Links
Mouse Anti-XAGE2 Polyclonal Antibody, Unconjugated from Abnova Corporation

ProductsMouse Anti-XAGE2 Polyclonal Antibody, Unconjugated from Abnova Corporation
Company Abnova Corporation
Item Mouse Anti-XAGE2 Polyclonal Antibody, Unconjugated
Price 
Description Mouse polyclonal antibody raised against a partial recombinant XAGE2.
Immunogen: XAGE2 (NP_570133, 44 a.a. ~ 112 a.a) partial recombinant protein with GST tag.
Accession Number: NM_130777
Protein Sequence: RNPTPDQKREDDQGAAEIQVPDLEADLQELCQTKTGDGCEGGTDVKGKILPKAEHFKMPEAGEGKSQV*
Info Abnova CorporationAbnova Corporation
Abnova Corporation (HQ)
9th Fl., No. 108, Jhouzih St.
Neihu District, Taipei
114 Taiwan R.O.C.
Tel: +886-2-8751-1888
Fax: +886-2-8751-1166

Abnova GmbH
Boxbergring 107
69126 Heidelberg
Germany
Tel: +49 6221 3632226
Fax: +49 6221 825878

Customer Service: +886-2-8751-1888
Fax Number: +886-2-8751-1166
Web Site: http://www.abnova.com.tw
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Mouse Anti-Amodiaquine Monoclonal Antibody, Unconjugated, Clone 6D10 from AntibodyShop A/S
2. Mouse Anti-Protein S Monoclonal Antibody, Unconjugated, Clone HYB 232-02 from Abcam
3. Mouse Anti-Mouse Glutathione S-transferase M1 (GSTM1) Monoclonal Antibody, Unconjugated from Lifespan Biosciences
4. Mouse Anti-Human S-100 alpha/beta chain Monoclonal Antibody, Unconjugated, Clone 8B10 from Santa Cruz Biotechnology, Inc.
5. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Testis from OriGene Technologies
6. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Brain (adult) from OriGene Technologies
7. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (12.5 - day) from OriGene Technologies
8. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (19 - day) from OriGene Technologies
9. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Thymus from OriGene Technologies
10. Mouse Anti-Human Complement factor B Monoclonal Antibody, Unconjugated, Clone 9B6 from AntibodyShop A/S
11. Mouse Anti-Human Choriongonadotropin (hCG) Monoclonal Antibody, Unconjugated, Clone 5F10 from AntibodyShop A/S
Large-fragment, single-stranded carrier DNA of the highest quality, perfectly suited for all types of yeast transformation....
... Custom Production Service - Conjugation ... Peroxidase Conjugation Biotin Conjugation Fluorescein ... Rhodamine Conjugation Allophycocyanin Conjugation Alexa ... Conjugation Alexa Fluor 405 Conjugation ...
Request Info...
... This Kit Contains the following: , Coated Capture ... sealers , Wash/Sample Diluent: 300 mL of 2X ... vial 10 microg lyophilized peptide , Lyophilized Standard ... of 50X concentrate , Secondary Antibody-HRP: 30 microL ...
Biology Products:
(Date:12/7/2016)... , Dec. 7, 2016   Veridium ... announced the appointment of new CEO James ... executive with decades of experience, has served in ... Cisco, where he specialized in expanding a pipeline ... technology portfolios. He most recently served as managing ...
(Date:12/2/2016)... , December 1, 2016 ... type (Fingerprint, Voice), Future Technology (Iris Recognition System), ... Region - Global Forecast to 2021", published by ... 442.7 Million in 2016, and is projected to ... a CAGR of 14.06%.      (Logo: ...
(Date:11/29/2016)... 29, 2016   Neurotechnology , a ... recognition technologies, today released FingerCell 3.0, a ... solutions that run on low-power, low-memory microcontrollers. ... less than 128KB of memory, enabling it ... have limited on-board resources, such as: mobile ...
Breaking Biology News(10 mins):
(Date:12/9/2016)... 9, 2016 The research report ... players in the  Global Label-Free Array Systems Market  accounted ... in 2015. Players such as Biacore, Agilent Technologies, ForteBio, ... in the global market due to their unmatched product ... Product upgrades and timely product launches are expected to ...
(Date:12/9/2016)... Dec. 9, 2016 China Cord Blood Corporation (NYSE: ... China,s leading provider of cord blood collection, laboratory ... today announced the results of its 2016 Annual General Meeting, ... S.A.R., China . At ... the re-appointment of KPMG Huazhen LLP as the independent auditors ...
(Date:12/9/2016)... According to a new market research report "Oligonucleotide Synthesis Market ... (Research, PCR, Gene, DNA, NGS, Diagnostic, RNAI), End user (Academic, Pharmaceutical, ... is expected to reach USD 2.20 Billion by 2021 from USD ... forecast period. Continue Reading ... ...
(Date:12/8/2016)... This report analyzes the worldwide markets for Biostimulants ... Amino, & Fulvic), Extract Based, and Others. The report also ... & Turf, Row Crops, and Others. The report provides separate ... Japan , Europe , ... , and Rest of World. Annual estimates and forecasts are ...
Breaking Biology Technology: