Navigation Links
Mouse Anti-XAGE2 Polyclonal Antibody, Unconjugated from Abnova Corporation

ProductsMouse Anti-XAGE2 Polyclonal Antibody, Unconjugated from Abnova Corporation
Company Abnova Corporation
Item Mouse Anti-XAGE2 Polyclonal Antibody, Unconjugated
Price 
Description Mouse polyclonal antibody raised against a partial recombinant XAGE2.
Immunogen: XAGE2 (NP_570133, 44 a.a. ~ 112 a.a) partial recombinant protein with GST tag.
Accession Number: NM_130777
Protein Sequence: RNPTPDQKREDDQGAAEIQVPDLEADLQELCQTKTGDGCEGGTDVKGKILPKAEHFKMPEAGEGKSQV*
Info Abnova CorporationAbnova Corporation
Abnova Corporation (HQ)
9th Fl., No. 108, Jhouzih St.
Neihu District, Taipei
114 Taiwan R.O.C.
Tel: +886-2-8751-1888
Fax: +886-2-8751-1166

Abnova GmbH
Boxbergring 107
69126 Heidelberg
Germany
Tel: +49 6221 3632226
Fax: +49 6221 825878

Customer Service: +886-2-8751-1888
Fax Number: +886-2-8751-1166
Web Site: http://www.abnova.com.tw
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Mouse Anti-Amodiaquine Monoclonal Antibody, Unconjugated, Clone 6D10 from AntibodyShop A/S
2. Mouse Anti-Protein S Monoclonal Antibody, Unconjugated, Clone HYB 232-02 from Abcam
3. Mouse Anti-Mouse Glutathione S-transferase M1 (GSTM1) Monoclonal Antibody, Unconjugated from Lifespan Biosciences
4. Mouse Anti-Human S-100 alpha/beta chain Monoclonal Antibody, Unconjugated, Clone 8B10 from Santa Cruz Biotechnology, Inc.
5. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Testis from OriGene Technologies
6. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Brain (adult) from OriGene Technologies
7. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (12.5 - day) from OriGene Technologies
8. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (19 - day) from OriGene Technologies
9. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Thymus from OriGene Technologies
10. Mouse Anti-Human Complement factor B Monoclonal Antibody, Unconjugated, Clone 9B6 from AntibodyShop A/S
11. Mouse Anti-Human Choriongonadotropin (hCG) Monoclonal Antibody, Unconjugated, Clone 5F10 from AntibodyShop A/S
... Biometras T1 Thermocycler provides high speed and ... optimized with a TGradient Thermocycler can be ... comes with a silver block for 48 ... 384 well plates or in-situ applications are ...
SDS-OutT SDS Precipitation Reagent...
Designed for use with the Agencourt SprintPrep 384 kit and all MCPrep reagent kits. Used with flat bottom 96-well microplates such as deep well plates used to culture bacteria....
... Disposable, clear, APET plastic tray. Ideal ... identify those trays used for multipurposes. Pour ... liquid. A marker or label may be ... stacking trays on rockers or shakers for ...
Biology Products:
(Date:3/23/2015)...   HOYOS Labs , a leading global authentication ... the Company will demonstrate multiple biometrics-based technologies under its ... Connect:ID on March 23 through 25, 2015, in ... the IEEE Biometric Open Protocol Standard; free biometrics-based consumer ... control system. BOPS was invented by HOYOS Labs and ...
(Date:3/20/2015)... 2015 Research and Markets ( ... "India Sensors Market Forecast and Opportunities 2020" ... sensor market is projected to grow at a ... electronics, automotive, industrial and healthcare sectors are the ... In addition, adoption of MEMS technology in sensors ...
(Date:3/20/2015)... Markets ( http://www.researchandmarkets.com/research/vkzvcs/iris_biometrics ) has announced the addition ... report to their offering. This report analyzes ... report provides separate comprehensive analytics for the US, ... Europe , Asia-Pacific , ... . Annual estimates and forecasts are provided for ...
Breaking Biology News(10 mins):HOYOS Labs to Showcase Host of Biometrics Technologies at Connect:ID in Washington, D.C. 2HOYOS Labs to Showcase Host of Biometrics Technologies at Connect:ID in Washington, D.C. 3India Sensors Market Forecast and Opportunities 2020 - STMicroelectronics held the largest share in 2014 2India Sensors Market Forecast and Opportunities 2020 - STMicroelectronics held the largest share in 2014 3Iris Biometrics - Global Strategic Business Report 2015: System & Network Access Control - A Robust Market Opportunity in the Offing 2Iris Biometrics - Global Strategic Business Report 2015: System & Network Access Control - A Robust Market Opportunity in the Offing 3Iris Biometrics - Global Strategic Business Report 2015: System & Network Access Control - A Robust Market Opportunity in the Offing 4Iris Biometrics - Global Strategic Business Report 2015: System & Network Access Control - A Robust Market Opportunity in the Offing 5
... leading global STM publishers, has entered a publishing partnership ... Estuaries and Coasts. Appearing six times a year, ... on and management of estuarine and coastal ecosystems. ... 2008. The partnership will be officially announced at ...
... had megadroughts more extreme and widespread than any previously known ... now-lush tropical Africa was an arid scrubland during the early ... Africa and the evolution of fishes in Africa,s Great Lakes. ... the world, acts as a rain gauge," said lead scientist ...
... by an Indiana University environmental science professor and several ... corn has the potential to harm aquatic ecosystems. The ... journal Proceedings of the National Academies of Sciences ... assistant professor in the IU School of Public and ...
Cached Biology News:Estuarine Research Federation chooses Springer as publishing partner 2Newfound ancient African megadroughts may have driven the evolution of humans and fishes 2Newfound ancient African megadroughts may have driven the evolution of humans and fishes 3Newfound ancient African megadroughts may have driven the evolution of humans and fishes 4Study shows genetically engineered corn could affect aquatic ecosystems 2Study shows genetically engineered corn could affect aquatic ecosystems 3
(Date:4/16/2015)... 2015 OncoTAb, Inc., ... Charlotte) spin-out company, announced today the appointment of ... as Chief Operating Officer (COO). Cooper brings to ... developing clinical diagnostic and biotechnology platforms in the ... Cooper’s extensive career transcends the field of medical ...
(Date:4/16/2015)... - Bioenterprise Corporation is pleased to announce that it will ... , PEI.  Bioenterprise has established a 3-year strategic ... the commercialization of agricultural technologies and innovations. ... They have been at the heart of agri-innovation in ... Dave Smardon , President & CEO of Bioenterprise Corporation.  ...
(Date:4/16/2015)... , April 16, 2015 Avelas Biosciences, ... to improving cancer surgeries, announced today that it has ... cancer illuminator, AVB-620, in women with primary, non-recurrent breast ... company also welcomed the addition of Steven Chen ... The open label, dose escalation study will enroll ...
(Date:4/16/2015)... BETHESDA, Md. , April 16, 2015 /PRNewswire/ ... Bio"), a biotechnology company developing non-toxic DCVax® personalized ... has been included in the Loncar Cancer Immunotherapy ... help investors better track the immunotherapy field within ... founders have selected "the top 25 companies" in ...
Breaking Biology Technology:OncoTAb Names Dr. David L. Cooper as COO 2Bioenterprise Corporation Expands into the Maritimes 2Avelas Biosciences Initiates Phase 1b Trial of AVB-620 in Breast Cancer Patients 2Avelas Biosciences Initiates Phase 1b Trial of AVB-620 in Breast Cancer Patients 3NW Bio Included In New Index Of The "Top 25 Cancer Immunotherapy Companies" 2NW Bio Included In New Index Of The "Top 25 Cancer Immunotherapy Companies" 3