Navigation Links
Mouse Anti-XAGE2 Polyclonal Antibody, Unconjugated from Abnova Corporation

ProductsMouse Anti-XAGE2 Polyclonal Antibody, Unconjugated from Abnova Corporation
Company Abnova Corporation
Item Mouse Anti-XAGE2 Polyclonal Antibody, Unconjugated
Price 
Description Mouse polyclonal antibody raised against a partial recombinant XAGE2.
Immunogen: XAGE2 (NP_570133, 44 a.a. ~ 112 a.a) partial recombinant protein with GST tag.
Accession Number: NM_130777
Protein Sequence: RNPTPDQKREDDQGAAEIQVPDLEADLQELCQTKTGDGCEGGTDVKGKILPKAEHFKMPEAGEGKSQV*
Info Abnova CorporationAbnova Corporation
Abnova Corporation (HQ)
9th Fl., No. 108, Jhouzih St.
Neihu District, Taipei
114 Taiwan R.O.C.
Tel: +886-2-8751-1888
Fax: +886-2-8751-1166

Abnova GmbH
Boxbergring 107
69126 Heidelberg
Germany
Tel: +49 6221 3632226
Fax: +49 6221 825878

Customer Service: +886-2-8751-1888
Fax Number: +886-2-8751-1166
Web Site: http://www.abnova.com.tw
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Mouse Anti-Amodiaquine Monoclonal Antibody, Unconjugated, Clone 6D10 from AntibodyShop A/S
2. Mouse Anti-Protein S Monoclonal Antibody, Unconjugated, Clone HYB 232-02 from Abcam
3. Mouse Anti-Mouse Glutathione S-transferase M1 (GSTM1) Monoclonal Antibody, Unconjugated from Lifespan Biosciences
4. Mouse Anti-Human S-100 alpha/beta chain Monoclonal Antibody, Unconjugated, Clone 8B10 from Santa Cruz Biotechnology, Inc.
5. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Testis from OriGene Technologies
6. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Brain (adult) from OriGene Technologies
7. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (12.5 - day) from OriGene Technologies
8. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (19 - day) from OriGene Technologies
9. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Thymus from OriGene Technologies
10. Mouse Anti-Human Complement factor B Monoclonal Antibody, Unconjugated, Clone 9B6 from AntibodyShop A/S
11. Mouse Anti-Human Choriongonadotropin (hCG) Monoclonal Antibody, Unconjugated, Clone 5F10 from AntibodyShop A/S
(Date:1/13/2016)... January 13, 2016 ... addition of the  "India Biometrics Authentication ... Forecast (2015-2020)"  report to their ... has announced the addition of the  ... - Estimation & Forecast (2015-2020)" ...
(Date:1/11/2016)... 11, 2016  higi, the leading retail and ... locations, web and mobile, today announced it has ... existing investors. --> ... further innovate higi,s health platform – its network ... – including expanding services and programs to retail ...
(Date:1/8/2016)... January 8, 2016 NXTD ), ... WorldVentures ® , a privately held leading direct seller ... Inc. 5000 fastest-growing company announced that on December ... $2 million in Nxt-ID to develop a proprietary new ... Wocket ® , a unique smart wallet that serves ...
Breaking Biology News(10 mins):
(Date:2/11/2016)... Miami (PRWEB) , ... February 11, 2016 , ... ... opening of its new stem cell treatment clinic in Quito, Ecuador. The new ... orthopedic and trauma applications to patients from around the world. , The ...
(Date:2/10/2016)... WASHINGTON , Feb.10, 2016 ASAE is ... and Association Management Companies (AMC) the option of joining ... flat annual fee determined by staff size, every employee ... to join ASAE and reap all available member benefits.   ... CAE. "Our new organizational membership options will allow organizations ...
(Date:2/10/2016)... ... February 10, 2016 , ... Benchmark Research, a fully-integrated ... of two long-standing principal investigators (PI) to the roles of Chief Medical Officer, ... , Dr. Laurence Chu, a Benchmark Research PI in the Austin office, will ...
(Date:2/10/2016)... ... 10, 2016 , ... Curoverse announced today that the open-source, ... capabilities for managing and processing genomic and health data at petabyte scale. ... and analyzing genomic data,” said Adam Berrey chief executive officer at Curoverse. “Microsoft ...
Breaking Biology Technology: