Navigation Links
Mouse Anti-XAGE2 Polyclonal Antibody, Unconjugated from Abnova Corporation

ProductsMouse Anti-XAGE2 Polyclonal Antibody, Unconjugated from Abnova Corporation
Company Abnova Corporation
Item Mouse Anti-XAGE2 Polyclonal Antibody, Unconjugated
Price 
Description Mouse polyclonal antibody raised against a partial recombinant XAGE2.
Immunogen: XAGE2 (NP_570133, 44 a.a. ~ 112 a.a) partial recombinant protein with GST tag.
Accession Number: NM_130777
Protein Sequence: RNPTPDQKREDDQGAAEIQVPDLEADLQELCQTKTGDGCEGGTDVKGKILPKAEHFKMPEAGEGKSQV*
Info Abnova CorporationAbnova Corporation
Abnova Corporation (HQ)
9th Fl., No. 108, Jhouzih St.
Neihu District, Taipei
114 Taiwan R.O.C.
Tel: +886-2-8751-1888
Fax: +886-2-8751-1166

Abnova GmbH
Boxbergring 107
69126 Heidelberg
Germany
Tel: +49 6221 3632226
Fax: +49 6221 825878

Customer Service: +886-2-8751-1888
Fax Number: +886-2-8751-1166
Web Site: http://www.abnova.com.tw
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Mouse Anti-Amodiaquine Monoclonal Antibody, Unconjugated, Clone 6D10 from AntibodyShop A/S
2. Mouse Anti-Protein S Monoclonal Antibody, Unconjugated, Clone HYB 232-02 from Abcam
3. Mouse Anti-Mouse Glutathione S-transferase M1 (GSTM1) Monoclonal Antibody, Unconjugated from Lifespan Biosciences
4. Mouse Anti-Human S-100 alpha/beta chain Monoclonal Antibody, Unconjugated, Clone 8B10 from Santa Cruz Biotechnology, Inc.
5. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Testis from OriGene Technologies
6. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Brain (adult) from OriGene Technologies
7. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (12.5 - day) from OriGene Technologies
8. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (19 - day) from OriGene Technologies
9. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Thymus from OriGene Technologies
10. Mouse Anti-Human Complement factor B Monoclonal Antibody, Unconjugated, Clone 9B6 from AntibodyShop A/S
11. Mouse Anti-Human Choriongonadotropin (hCG) Monoclonal Antibody, Unconjugated, Clone 5F10 from AntibodyShop A/S
... family of human cullin genes (CUL-1, -2, -3, -4a, ... gene. Cullin-3 is proposed to be a part of ... cyclin E and targets it for ubiquitination, which leads ... activator of cdk2, which leads the cell to S ...
... the cost-effective solution for entry level imaging ... research imaging tasks, MetaVue enables time lapse, ... analysis. Compatibility with MetaMorphs extensive and ... has the power to drive motorized microscopes, ...
... for microRNA expression profiling ,miRCURY ... Locked Nucleic Acid (LNA) technology to provide ... short microRNA (miRNA) targets. miRCURY LNA Arrays ... RNA (no need for microRNA enrichment) labeled ...
... LTQ XL extends the MSn performance of ... new tools to generate extensive structural information ... applications. , Multiple dissociation techniques (PQD, ... and unpredicted metabolites , Fast polarity switching ...
Biology Products:
(Date:2/28/2017)... , Spanien, 27. Februar 2017  EyeLock LLC, ein ... wird seine erstklassige biometrische Lösung zur Iris-Erkennung ... mit X16 LTE auf dem Mobile World ... am Qualcomm-Stand in Halle 3, Stand 3E10, ... die Sicherheitsplattform Qualcomm Haven™ – eine Kombination ...
(Date:2/22/2017)... , Feb. 22, 2017 With ... 2021, ABI Research identifies four technologies that innovative ... to secure significant share in the changing competitive ... and passive authentication.   "Companies can ... comes to security," says Dimitrios Pavlakis , ...
(Date:2/14/2017)... -- Wake Forest Baptist Medical Center today announced Julie Ann Freischlag, ... (CEO). Freischlag joins the medical center on May 1 ... who last year announced that he would transition to ... it since 2008.   As CEO, Freischlag ... academic health system, which includes Wake Forest School of ...
Breaking Biology News(10 mins):
(Date:3/23/2017)... York , March 23, 2017 According ... plasma products and derivatives market is fragmented due to the presence of ... such as Proliant, Thermo Fisher , and Sigma-Aldrich, compete with ... these three companies, collectively, held more than 76% of this market ... As ...
(Date:3/23/2017)... La. (PRWEB) , ... March 23, 2017 , ... ... industrial monitoring solutions, today announced the hire of Dr. Sigmund “Sig” Floyd as ... customer applications, strategic partnerships and joint development activities. , “Dr. Floyd’s career has ...
(Date:3/22/2017)...  Ascendis Pharma A/S (Nasdaq: ASND), a biopharmaceutical ... address significant unmet medical needs in rare diseases, ... ended December 31, 2016. "2016 ... we broadened our pipeline and pursued our vision ... with an initial focus on endocrinology," said ...
(Date:3/22/2017)... March 22, 2017 Oramed Pharmaceuticals Inc. ... www.oramed.com ), a clinical-stage pharmaceutical ... delivery systems, announced today that Dr. Miriam ... a presentation titled, "Oral Insulin for Diabetes Treatment: ... Healthtech Institute,s Oligonucleotide and Peptide Therapeutics (OPT) Boston Conference in ...
Breaking Biology Technology: