Navigation Links
Mouse Anti-XAGE2 Polyclonal Antibody, Unconjugated from Abnova Corporation

ProductsMouse Anti-XAGE2 Polyclonal Antibody, Unconjugated from Abnova Corporation
Company Abnova Corporation
Item Mouse Anti-XAGE2 Polyclonal Antibody, Unconjugated
Price 
Description Mouse polyclonal antibody raised against a partial recombinant XAGE2.
Immunogen: XAGE2 (NP_570133, 44 a.a. ~ 112 a.a) partial recombinant protein with GST tag.
Accession Number: NM_130777
Protein Sequence: RNPTPDQKREDDQGAAEIQVPDLEADLQELCQTKTGDGCEGGTDVKGKILPKAEHFKMPEAGEGKSQV*
Info Abnova CorporationAbnova Corporation
Abnova Corporation (HQ)
9th Fl., No. 108, Jhouzih St.
Neihu District, Taipei
114 Taiwan R.O.C.
Tel: +886-2-8751-1888
Fax: +886-2-8751-1166

Abnova GmbH
Boxbergring 107
69126 Heidelberg
Germany
Tel: +49 6221 3632226
Fax: +49 6221 825878

Customer Service: +886-2-8751-1888
Fax Number: +886-2-8751-1166
Web Site: http://www.abnova.com.tw
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Mouse Anti-Amodiaquine Monoclonal Antibody, Unconjugated, Clone 6D10 from AntibodyShop A/S
2. Mouse Anti-Protein S Monoclonal Antibody, Unconjugated, Clone HYB 232-02 from Abcam
3. Mouse Anti-Mouse Glutathione S-transferase M1 (GSTM1) Monoclonal Antibody, Unconjugated from Lifespan Biosciences
4. Mouse Anti-Human S-100 alpha/beta chain Monoclonal Antibody, Unconjugated, Clone 8B10 from Santa Cruz Biotechnology, Inc.
5. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Testis from OriGene Technologies
6. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Brain (adult) from OriGene Technologies
7. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (12.5 - day) from OriGene Technologies
8. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (19 - day) from OriGene Technologies
9. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Thymus from OriGene Technologies
10. Mouse Anti-Human Complement factor B Monoclonal Antibody, Unconjugated, Clone 9B6 from AntibodyShop A/S
11. Mouse Anti-Human Choriongonadotropin (hCG) Monoclonal Antibody, Unconjugated, Clone 5F10 from AntibodyShop A/S
... long and outstanding history in the ... ago we became aware that our ... modified to inject Xenopus oocytes. We ... microdispenser to eliminate any tip movement ...
Coating : Poly-D-Lysine ,Surface : ECM/attachment factors ,Surface area : 9.6 cm2 ,Dim nominal : 35 mm x 10 mm ,Vol working : 2.5-3.0 ml ...
Rabbit polyclonal to Synapsin II ( Abpromise for all tested applications). entrezGeneID: 6854 SwissProtID: Q92777...
... primers are designed for sequencing inserts cloned ... T7, or T3 RNA polymerase promoters, or ... supplied at a concentration of 0.1 µg/µl ... in DNA sequencing reactions using SequiTherm™ EXCEL™ ...
Biology Products:
(Date:3/29/2017)... 2017  higi, the health IT company that operates ... America , today announced a Series B investment ... EveryMove. The new investment and acquisition accelerates higi,s strategy ... transform population health activities through the collection and workflow ... higi collects and secures data today on behalf of ...
(Date:3/23/2017)... The report "Gesture Recognition and Touchless Sensing Market by ... Global Forecast to 2022", published by MarketsandMarkets, the market is expected to be ... 2017 and 2022. Continue Reading ... ... ...
(Date:3/20/2017)... 2017 At this year,s CeBIT Chancellor Dr. ... DERMALOG. The Chancellor came to the DERMALOG stand together with the Japanese ... CeBIT partner country. At the largest German biometrics company the two government ... and iris recognition as well as DERMALOG´s multi-biometrics system.   ... ...
Breaking Biology News(10 mins):
(Date:6/16/2017)... ... 16, 2017 , ... Cambridge Semantics , the leading ... Smart Data Lake® (Anzo SDL) solution was named a finalist in the ... Information Industry Association (SIIA) CODiE Awards. , Finalists represent the best products, ...
(Date:6/15/2017)... ... 15, 2017 , ... New resistant soybean and cotton cropping ... Palmer amaranth and other broadleaf weeds resistant to glyphosate. But scientists with the ... are known to drift and to cause harm to sensitive, off-target broadleaf plants. ...
(Date:6/15/2017)... ... June 15, 2017 , ... The newest exhibition ... journey through creative experimentation and interdisciplinary collaboration. Feature Creep, a solo exhibition by ... opening reception will be held at EKG, located at 3600 Market Street in ...
(Date:6/15/2017)... ... June 15, 2017 , ... DuPont Industrial Biosciences (DuPont) ... speaking at Bloomberg’s 2017 Sustainable Business Summit: Seattle this Thursday, June ... officials on a panel titled “Developing a Corporate Renewables Strategy.” , “Consumers ...
Breaking Biology Technology: