Navigation Links
Mouse Anti-XAGE2 Polyclonal Antibody, Unconjugated from Abnova Corporation

ProductsMouse Anti-XAGE2 Polyclonal Antibody, Unconjugated from Abnova Corporation
Company Abnova Corporation
Item Mouse Anti-XAGE2 Polyclonal Antibody, Unconjugated
Price 
Description Mouse polyclonal antibody raised against a partial recombinant XAGE2.
Immunogen: XAGE2 (NP_570133, 44 a.a. ~ 112 a.a) partial recombinant protein with GST tag.
Accession Number: NM_130777
Protein Sequence: RNPTPDQKREDDQGAAEIQVPDLEADLQELCQTKTGDGCEGGTDVKGKILPKAEHFKMPEAGEGKSQV*
Info Abnova CorporationAbnova Corporation
Abnova Corporation (HQ)
9th Fl., No. 108, Jhouzih St.
Neihu District, Taipei
114 Taiwan R.O.C.
Tel: +886-2-8751-1888
Fax: +886-2-8751-1166

Abnova GmbH
Boxbergring 107
69126 Heidelberg
Germany
Tel: +49 6221 3632226
Fax: +49 6221 825878

Customer Service: +886-2-8751-1888
Fax Number: +886-2-8751-1166
Web Site: http://www.abnova.com.tw
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Mouse Anti-Amodiaquine Monoclonal Antibody, Unconjugated, Clone 6D10 from AntibodyShop A/S
2. Mouse Anti-Protein S Monoclonal Antibody, Unconjugated, Clone HYB 232-02 from Abcam
3. Mouse Anti-Mouse Glutathione S-transferase M1 (GSTM1) Monoclonal Antibody, Unconjugated from Lifespan Biosciences
4. Mouse Anti-Human S-100 alpha/beta chain Monoclonal Antibody, Unconjugated, Clone 8B10 from Santa Cruz Biotechnology, Inc.
5. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Testis from OriGene Technologies
6. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Brain (adult) from OriGene Technologies
7. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (12.5 - day) from OriGene Technologies
8. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (19 - day) from OriGene Technologies
9. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Thymus from OriGene Technologies
10. Mouse Anti-Human Complement factor B Monoclonal Antibody, Unconjugated, Clone 9B6 from AntibodyShop A/S
11. Mouse Anti-Human Choriongonadotropin (hCG) Monoclonal Antibody, Unconjugated, Clone 5F10 from AntibodyShop A/S
... Identical to the D-2000, but comes with a ... The D-2000 Deuterium Light Source ... In addition, deep-UV versions of the light source ... nm. This powerful and stable lamp provides peak-to-peak ...
... mitochondria intactness and detects events that ... and Benefits: Fast, simple, ... mitochondria and for assaying mitochondria intactness ... required for the detection of changes ...
... These handy dispensers save space ... wipers, hats, and other garb. ... storage bins for small parts ... manufacturing. Clear acrylic. Many other ...
... space and organize gloves, safety glasses, ... are the perfect benchtop storage bins ... processing and manufacturing. Clear static-dissipative PVC ... they attract. Open-slot design for easy ...
Biology Products:
(Date:8/23/2017)... , Aug. 23, 2017  The general public,s help is being enlisted ... bacteria that live in and on the human body –and are believed ... The Microbiome Immunity ... human microbiome, starting with the gut. The project's goal is to help ... credit: IBM ...
(Date:6/14/2017)... IBM ) is introducing several innovative partner startups at ... between startups and global businesses, taking place in ... startups will showcase the solutions they have built with IBM ... France is one of the most ... increase in the number of startups created between 2012 and ...
(Date:4/24/2017)... Janice Kephart , former 9/11 ... Partners, LLP (IdSP) , today issues the following ... March 6, 2017 Executive Order: Protecting the ... be instilled with greater confidence, enabling the reactivation ... applications are suspended by until at least July ...
Breaking Biology News(10 mins):
(Date:10/10/2017)... ... October 10, 2017 , ... The Pittcon ... awards honoring scientists who have made outstanding contributions to analytical chemistry ... Pittcon 2018, the world’s leading conference and exposition for laboratory science, which will ...
(Date:10/9/2017)... ... October 09, 2017 , ... The award-winning American Farmer television series will feature ... Farmer airs Tuesdays at 8:30aET on RFD-TV. , With global population estimates nearing ... how to continue to feed a growing nation. At the same time, many of ...
(Date:10/9/2017)... ... October 09, 2017 , ... ... line of medical marijuana products targeting the needs of consumers who are incorporating ... Kindred takes place in Phoenix, Arizona. , As operators of two successful Valley ...
(Date:10/7/2017)... ... October 06, 2017 , ... ... consulting for microscopy and surface analysis, Nanoscience Instruments is now expanding into ... a broad range of contract analysis services for advanced applications. Services will ...
Breaking Biology Technology: