Navigation Links
Mouse Anti-XAGE2 Polyclonal Antibody, Unconjugated from Abnova Corporation

ProductsMouse Anti-XAGE2 Polyclonal Antibody, Unconjugated from Abnova Corporation
Company Abnova Corporation
Item Mouse Anti-XAGE2 Polyclonal Antibody, Unconjugated
Price 
Description Mouse polyclonal antibody raised against a partial recombinant XAGE2.
Immunogen: XAGE2 (NP_570133, 44 a.a. ~ 112 a.a) partial recombinant protein with GST tag.
Accession Number: NM_130777
Protein Sequence: RNPTPDQKREDDQGAAEIQVPDLEADLQELCQTKTGDGCEGGTDVKGKILPKAEHFKMPEAGEGKSQV*
Info Abnova CorporationAbnova Corporation
Abnova Corporation (HQ)
9th Fl., No. 108, Jhouzih St.
Neihu District, Taipei
114 Taiwan R.O.C.
Tel: +886-2-8751-1888
Fax: +886-2-8751-1166

Abnova GmbH
Boxbergring 107
69126 Heidelberg
Germany
Tel: +49 6221 3632226
Fax: +49 6221 825878

Customer Service: +886-2-8751-1888
Fax Number: +886-2-8751-1166
Web Site: http://www.abnova.com.tw
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Mouse Anti-Amodiaquine Monoclonal Antibody, Unconjugated, Clone 6D10 from AntibodyShop A/S
2. Mouse Anti-Protein S Monoclonal Antibody, Unconjugated, Clone HYB 232-02 from Abcam
3. Mouse Anti-Mouse Glutathione S-transferase M1 (GSTM1) Monoclonal Antibody, Unconjugated from Lifespan Biosciences
4. Mouse Anti-Human S-100 alpha/beta chain Monoclonal Antibody, Unconjugated, Clone 8B10 from Santa Cruz Biotechnology, Inc.
5. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Testis from OriGene Technologies
6. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Brain (adult) from OriGene Technologies
7. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (12.5 - day) from OriGene Technologies
8. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (19 - day) from OriGene Technologies
9. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Thymus from OriGene Technologies
10. Mouse Anti-Human Complement factor B Monoclonal Antibody, Unconjugated, Clone 9B6 from AntibodyShop A/S
11. Mouse Anti-Human Choriongonadotropin (hCG) Monoclonal Antibody, Unconjugated, Clone 5F10 from AntibodyShop A/S
BD BaculoGold Max-XP Insect Cell Medium 1 Liter...
Performance, mycoplasma, virus, and endotoxin tested...
... Gel Loading Buffer is ... and tracking of DNA ... native polyacrylamide gels. This ... density sucrose which allows ...
... TOPO Cloning is ... available for cloning PCR ... and Zero Blunt TOPO ... and activated with topoisomerase ...
Biology Products:
(Date:12/19/2016)... TORONTO , 19 de diciembre de 2016  Mosaic Biomedicals ... el desarrollo acelerado de MSC-1, un anticuerpo humanizado que se espera ... en 2017, con múltiples sitios previstos a lo largo de Europa ... MSC-1 ... factor inhibidor de leucemia (LIF), una citoquina pleiotrópica que se sobreexpresa ...
(Date:12/15/2016)... FREMONT, Calif. , Dec. 15, 2016   ... a publicly held genomics technology company, announced today that ... the Listing Qualifications Department of The Nasdaq Stock Market ... the closing bid price of WaferGen,s common stock had ... days.  Accordingly, WaferGen has regained compliance with Listing Rule ...
(Date:12/12/2016)... Dec. 12, 2016  Researchers at Trinity College, ... graphene by combining the material with Silly Putty. The ... pressure detector able to sense pulse, blood pressure, ... spider.  The research team,s findings ... read here:  http://science.sciencemag.org/content/354/6317/1257 ...
Breaking Biology News(10 mins):
(Date:1/23/2017)... (PRWEB) , ... January 23, 2017 , ... ... replacement at the Caribbean Neurosciences Symposium (CANS) annual meeting in Montego Bay, Jamaica ... technology and host a hands-on workshop for surgeons to experience the simplicity of ...
(Date:1/21/2017)... , ... January 21, 2017 , ... ... endeavors to bring to market a pioneering medical device for the treatment of ... an engagement contract with Emergo, a global regulatory consultancy that helps companies like ...
(Date:1/21/2017)... 2017   Boston Biomedical , an industry leader ... cancer stemness pathways, today presented data from two clinical ... 2017 American Society of Clinical Oncology (ASCO) Gastrointestinal Cancers ... In a Phase Ib/II study of napabucasin ... cancer stemness pathways by targeting STAT3 – colorectal cancer ...
(Date:1/20/2017)... NEW YORK , January 20, 2017 ... Health Organization, cancer is one of leading causes of ... in 2012. Although the number of cancer related deaths ... since 1990. Rising in incidence rate of various cancers ... According to a research report by Global Market Insights, ...
Breaking Biology Technology: