Navigation Links
Mouse Anti-XAGE2 Polyclonal Antibody, Unconjugated from Abnova Corporation

ProductsMouse Anti-XAGE2 Polyclonal Antibody, Unconjugated from Abnova Corporation
Company Abnova Corporation
Item Mouse Anti-XAGE2 Polyclonal Antibody, Unconjugated
Price 
Description Mouse polyclonal antibody raised against a partial recombinant XAGE2.
Immunogen: XAGE2 (NP_570133, 44 a.a. ~ 112 a.a) partial recombinant protein with GST tag.
Accession Number: NM_130777
Protein Sequence: RNPTPDQKREDDQGAAEIQVPDLEADLQELCQTKTGDGCEGGTDVKGKILPKAEHFKMPEAGEGKSQV*
Info Abnova CorporationAbnova Corporation
Abnova Corporation (HQ)
9th Fl., No. 108, Jhouzih St.
Neihu District, Taipei
114 Taiwan R.O.C.
Tel: +886-2-8751-1888
Fax: +886-2-8751-1166

Abnova GmbH
Boxbergring 107
69126 Heidelberg
Germany
Tel: +49 6221 3632226
Fax: +49 6221 825878

Customer Service: +886-2-8751-1888
Fax Number: +886-2-8751-1166
Web Site: http://www.abnova.com.tw
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Mouse Anti-Amodiaquine Monoclonal Antibody, Unconjugated, Clone 6D10 from AntibodyShop A/S
2. Mouse Anti-Protein S Monoclonal Antibody, Unconjugated, Clone HYB 232-02 from Abcam
3. Mouse Anti-Mouse Glutathione S-transferase M1 (GSTM1) Monoclonal Antibody, Unconjugated from Lifespan Biosciences
4. Mouse Anti-Human S-100 alpha/beta chain Monoclonal Antibody, Unconjugated, Clone 8B10 from Santa Cruz Biotechnology, Inc.
5. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Testis from OriGene Technologies
6. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Brain (adult) from OriGene Technologies
7. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (12.5 - day) from OriGene Technologies
8. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (19 - day) from OriGene Technologies
9. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Thymus from OriGene Technologies
10. Mouse Anti-Human Complement factor B Monoclonal Antibody, Unconjugated, Clone 9B6 from AntibodyShop A/S
11. Mouse Anti-Human Choriongonadotropin (hCG) Monoclonal Antibody, Unconjugated, Clone 5F10 from AntibodyShop A/S
CMRL Medium-1066 (1X) liquid...
... The PhosphatidylEthanolamine-Binding Protein (PEBP) does not ... protease inhibitors. PEBP is expressed ... testis, ovary, muscle, and stomach. ... in is exerting inhibitory activity against ...
karyopherin alpha2 (2G7)...
50 assays. Provides an easy system for rapid separation of cytosol and particulate fractions that are compatiable with downstream studies....
Biology Products:
(Date:5/22/2013)... Trial (NLST) investigators also conclude that the 20 ... computed tomography (LDCT) versus chest X-ray (CXR) screening ... achievable at experienced screening centers in the United ... share with their patients about the benefits and ... publication in the New England Journal of ...
(Date:5/22/2013)... that can detect molecular variants in chemical mixtures ... most important, though time-consuming, processes in analytical chemistry. ... , post-doctoral researcher David Patterson, Professor of Physics John ... Free-Electron Laser Science (CFEL) in Hamburg, Germany developed a ... molecular variants apart, and to determine how much variant ...
(Date:5/22/2013)... 2013)The omega 3 fatty acids in fish oil have ... so that the American Heart Association currently recommends eating ... fatty varieties rich in omega 3s. However, the mechanism ... a new study, scientists led by Jason R. Carter ... by providing evidence that fish oil might specifically counteract ...
Breaking Biology News(10 mins):NLST: CT detects twice as many lung cancers as X-ray at initial screening exam 2NLST: CT detects twice as many lung cancers as X-ray at initial screening exam 3Detecting mirror molecules 2Detecting mirror molecules 3Fish oil may help the heart beat mental stress 2
... Foundation has granted two Clemson University professors $250,000 to ... 10 times smaller in diameter than a human hair ... both money and time compared to more traditional methods ... work like a sponge to draw up fluids from ...
... ESA and European industries have updated the planning of ... of 27 October 2008 for the GOCE satellite. ... GOCE from the Plesetsk Cosmodrome in northern Russia were ... one of the units of the guidance and navigation ...
... dinosaurs that perished in a catastrophic event 72.5 million ... frill on the back of the skull ornamented with ... their nose and eyes which lends them their name: ... keratin. According to Dr. Philip Currie, renowned palaeontologist ...
Cached Biology News:A new dinosaur species, Pachyrhinosaur lakustai, unveiled from Pipestone Creek, Alberta, Canada 2
(Date:5/23/2013)... May 23, 2013 PuraMed BioScience ® ... marketer of over-the-counter (OTC) medicinal and healthcare products, ... on the company based on low market capitalization ... Non-Prescription, All Natural Product to Treat Migraine Headaches ... #1 Prescription Competitor , Currently Available Nationwide ...
(Date:5/23/2013)... (PRWEB) May 23, 2013 PI’s ... wide and provide 15 mm travel range with ... The small dimensions make these new positioners the ... spaces. A vacuum rated version is also available. ... specifications and datasheets can be found at: , ...
(Date:5/23/2013)... , May 23, 2013 Virobay, Inc. ... for pain has reached an important milestone, as Virobay ... VBY-036 - a selective cathepsin S inhibitor.   ... a double-blind, randomized, placebo-controlled study designed to evaluate the ... VBY-036 in healthy adults. "The initiation of ...
(Date:5/23/2013)... , May 23, 2013 Z Trim ... value-added ingredients to a variety of industries, announced that ... a panel discussion at this year,s National Restaurant Association ... 2013, on behalf of the Research Chefs Association.  Chef ... Restaurants: The Good, the Bad and the Ugly," joining ...
Breaking Biology Technology:PuraMed BioScience (PMBS) Issued Alert Based on Market Cap of $721,756 2PuraMed BioScience (PMBS) Issued Alert Based on Market Cap of $721,756 3Precision Positioning System Uses Miniaturezed Piezo Linear Motor: LPS-24 Linear Stage by PI 2Virobay, Inc. initiates a Phase 1 Trial of VBY-036, a compound intended for the treatment of neuropathic pain 2Virobay, Inc. initiates a Phase 1 Trial of VBY-036, a compound intended for the treatment of neuropathic pain 3Z Trim's Chef Erin Ryan sits on Expert Panel at NRA Show 2Z Trim's Chef Erin Ryan sits on Expert Panel at NRA Show 3