Mouse Anti-XAGE2 Polyclonal Antibody, Unconjugated from Abnova Corporation

DNase I, RNase-free; special quality for molecular biology from Roche Applied Science

... E. coli containing a clone of the human Topoisome...ters the topological state of nucleic acids by pas... which generates a separate DNA helix (1,2) . As a...sm, the enzyme can relax negatively or positively ...

...ease-free Klenow Fragment is a genetically enginee...ase activity has been removed, leaving only the 5 ...clease activity makes Exo- Klenow Fragment the enz...NA probes by the random primed method, and for DNA...

Klenow Enzyme; labeling grade, DNA Polymerase I, large fragment from Roche Applied Science

Biology Products:

DNase I, RNase-free; special quality for molecular biology from Roche Applied Science Human Topoisomerase II, Alpha from USB Corp.Exo- Klenow Fragment (Cloned) from Ambion Klenow Enzyme; labeling grade, DNA Polymerase I, large fragment from Roche Applied Science

(Date:11/24/2009)...Rocket science is opening new doors to understandi...ect the hearing of a marine mammal or if they hea... sized X-ray scanners that NASA uses to detect fla...ets is now allowing scientists to peek inside the ...ailed three-dimensional replicas of a whale,s hear...

(Date:11/24/2009)..., NEW YORK (November 24, 2009) -- Th...day a report revealing that the last remaining pop...nificantly due to the rising tide of poaching and ...will help inform Russian officials of what needs t...world,s biggest cat. , The report w...

(Date:11/23/2009)...CINCINNATINew research presents strong evidence th... to both outdoor traffic-related pollution and ind... than one or the other exposure alone. , Envir...ncinnati (UC) College of Medicine have shown that ...lated particles and indoor endotoxin during early ...

Breaking Biology News(10 mins):Rocket science leads to new whale discovery 2 Report shows dramatic decline in Siberian tigers 2 Exposure to both traffic, indoor pollutants puts some kids at higher risk for asthma later 2 HPV Vaccine Acceptability Study Announces Results 48959 1 HPV Vaccine Acceptability Study Announces Results 48959 2 HPV Vaccine Acceptability Study Announces Results 48959 3 Endologix Announces Live Web Cast of Presentation in SMH Capital Small Cap Spotlight on June 17 2009 at 4 3A15 p m ET 48957 1 Endologix Announces Live Web Cast of Presentation in SMH Capital Small Cap Spotlight on June 17 2009 at 4 3A15 p m ET 48957 2 Heart Association Warns of Surgery Risks in Obese 48956 1 Heart Association Warns of Surgery Risks in Obese 48956 2

[1] Rocket science leads to new whale discovery [1] Report shows dramatic decline in Siberian tigers [0] Exposure to both traffic, indoor pollutants puts some kids at higher risk for asthma later

...ew Haven, Conn. David Spiegel , assistant profes... $1.5 million National Institutes of Health (NIH) ...s work designing a rational approach for using ant...ase types. , The New Innovator Awards are reserv...re just beginning their careers and have not yet r...

...adrid, Spain - Spanish authorities have announced ...on of Iberian lynx, triggering hope for one of the...ldlife Fund today. , We are excited and amazed by...ecies Program in Spain. However, we are a long way...tion. , It appears that the new population was di...

...AST LANSING, Mich. The computer program Captains L...h attention deficit hyperactivity disorder, brain ...d to rehabilitate Ugandan children who are survivo...gan State University associate professor of neurol... Giordani, a University of Michigan associate prof...

Other Biology News:Yale chemist receives NIH Young Investigator Award for antibody targeting 2 Yale chemist receives NIH Young Investigator Award for antibody targeting 3 MSU researcher helps develop computer game for Ugandan children recovering from cerebral malaria 2

Yale chemist receives NIH Young Investigator Award for antibody targeting New population of Iberian lynx raises hope, says World Wildlife Fund MSU researcher helps develop computer game for Ugandan children recovering from cerebral malaria

(Date:11/25/2009)...re/-CytochromatodayannouncedtheappointmentofPeterM...r.UlrikSporkastheNovoA/SrepresentativeontheCompany...ixmembers. ,, "WeareverypleasedtowelcomePeterMo...rienceandguidanceasCytochromacontinuestomakeprogre...icalcompany,"statedAlanLewis,PhD,ChairmanofCytochr...

(Date:11/25/2009)...--Reportlinker.comannouncesthatanewmarketresearchr...hanolMarketAnalysisandForecaststo2013 ,, http...-Market-Analysis-and-Forecasts-to-2013.html ,,...,, Summary ,, Thereportprovidesdetailedana...Brazilbioethanolmarketinparticular.Italsohelpsinan...

(Date:11/24/2009)...erman . , Whether it,s CD packaging, contain...uency Identification) are increasingly finding the...o label objects or goods and identify them automat... can read and process the data contained in the la...oduction conditions of up to 100 degrees Celsius. ...

(Date:11/24/2009)...or to also Visit Detroit , ...ia, French Ambassador for International Investment...ncy, , , , ,What: Ambassador Appia is available t...nitiatives adopted by France to further develop th...ovation and development., , ,When: Available for I...

[0] Cytochroma Announces Appointment of Peter Moldt to Board of Directors [0] Reportlinker Adds Brazil Bioethanol Market Analysis and Forecasts to 2013 [0] Intelligence inside metal components [0] French Ambassador for International Investment to Visit Chicago December 9 and 10

Products	Mouse Anti-XAGE2 Polyclonal Antibody, Unconjugated from Abnova Corporation
Company	Abnova Corporation
Item	Mouse Anti-XAGE2 Polyclonal Antibody, Unconjugated
Price
Description	Mouse polyclonal antibody raised against a partial recombinant XAGE2. Immunogen: XAGE2 (NP_570133, 44 a.a. ~ 112 a.a) partial recombinant protein with GST tag. Accession Number: NM_130777 Protein Sequence: RNPTPDQKREDDQGAAEIQVPDLEADLQELCQTKTGDGCEGGTDVKGKILPKAEHFKMPEAGEGKSQV*
Info	Abnova Corporation Abnova Corporation (HQ) 9th Fl., No. 108, Jhouzih St. Neihu District, Taipei 114 Taiwan R.O.C. Tel: +886-2-8751-1888 Fax: +886-2-8751-1166 Abnova GmbH Boxbergring 107 69126 Heidelberg Germany Tel: +49 6221 3632226 Fax: +49 6221 825878 Customer Service: +886-2-8751-1888 Fax Number: +886-2-8751-1166 Web Site: http://www.abnova.com.tw