Navigation Links
Mouse Anti-TOPORS Monoclonal Antibody, Unconjugated, Clone 4G4 from Abnova Corporation

ProductsMouse Anti-TOPORS Monoclonal Antibody, Unconjugated, Clone 4G4 from Abnova Corporation
Company Abnova Corporation
Item Mouse Anti-TOPORS Monoclonal Antibody, Unconjugated, Clone 4G4
Price 
Description Mouse monoclonal antibody raised against a partial recombinant TOPORS.
Immunogen: TOPORS (NP_005793, 98 a.a. ~ 206 a.a) partial recombinant protein with GST tag.
Accession Number: NM_005802
Protein Sequence: SPDSKCPICLDRFDNVSYLDRCLHKFCFRCVQEWSKNKAECPLCKQPFDSIFHSVRAEDDFKEYVLRPSYNGSFVTPDRRFRYRTTLTRERNASVYSPSGPVNRRTTT*
Info Abnova CorporationAbnova Corporation
Abnova Corporation (HQ)
9th Fl., No. 108, Jhouzih St.
Neihu District, Taipei
114 Taiwan R.O.C.
Tel: +886-2-8751-1888
Fax: +886-2-8751-1166

Abnova GmbH
Boxbergring 107
69126 Heidelberg
Germany
Tel: +49 6221 3632226
Fax: +49 6221 825878

Customer Service: +886-2-8751-1888
Fax Number: +886-2-8751-1166
Web Site: http://www.abnova.com.tw
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Mouse Anti-Amodiaquine Monoclonal Antibody, Unconjugated, Clone 6D10 from AntibodyShop A/S
2. Mouse Anti-Protein S Monoclonal Antibody, Unconjugated, Clone HYB 232-02 from Abcam
3. Mouse Anti-Mouse Glutathione S-transferase M1 (GSTM1) Monoclonal Antibody, Unconjugated from Lifespan Biosciences
4. Mouse Anti-Human S-100 alpha/beta chain Monoclonal Antibody, Unconjugated, Clone 8B10 from Santa Cruz Biotechnology, Inc.
5. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Testis from OriGene Technologies
6. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Brain (adult) from OriGene Technologies
7. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (12.5 - day) from OriGene Technologies
8. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (19 - day) from OriGene Technologies
9. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Thymus from OriGene Technologies
10. Mouse Anti-Human Complement factor B Monoclonal Antibody, Unconjugated, Clone 9B6 from AntibodyShop A/S
11. Mouse Anti-Human Choriongonadotropin (hCG) Monoclonal Antibody, Unconjugated, Clone 5F10 from AntibodyShop A/S
Mouse monoclonal [6C3] to JAB1 ( Abpromise for all tested applications). entrezGeneID: 10987 SwissProtID: O15386
Human SDNSF/MCFD2 Biotinylated Affinity Purified PAb
dithiothreitol, sulfhydryl reducing agent, C4H10O2S2; MW: 154.24, 97% pure (minimum), CAS No: 27565-41-9, store at -20 C
Human SCP3 Affinity Purified Polyclonal Ab Keywords: Spermatogenesis, meiosis Protein Family: Cell Cycle
Biology Products:
(Date:10/10/2008)...ale scientists have created nanowire sensors coupl... both sensitive and specific enough to be used for...to a report in Nano Letters . , The sensors use...igens signatures of bacteria, viruses or cancer c... they produce acid, and generate a tiny current in...
(Date:10/10/2008)...ailable in German . , DNA, the molecule that ...forms of life, is highly resistant against alterat...chanism for its photostability presents some puzzl...een the four chemical bases that make up the DNA m...eded in showing that DNA strands differ in their l...
(Date:10/9/2008)...egistration to the IOF World Congress on Osteoporo...e only until October 31, 2008. , To benefit fro... http://www.iofbonehealth.org/wco/2008/homepage.ht...participants from non-OECD countries and for IOF m...ration, at higher rates, will be possible. , Yo...
(Date:10/9/2008)...ct. 9 /PRNewswire-FirstCall/ -- Aware, Inc. (Nasda...gy and biometrics software,has scheduled a confer...ts,for the third quarter of 2008 on Thursday, Octo...el Tzannes and CFO Rick Moberg will host the,earni...by Thomson and can be accessed on the,Investor Rel...
Breaking Biology News(10 mins):Sensitive nanowire disease detectors made by Yale scientists 2Can genetic information be controlled by light? 2Aware Announces Q3 2008 Earnings Conference Call 2Siemens Introduces New Dual Energy Applications to SOMATOM Definition 13908 1Siemens Introduces New Dual Energy Applications to SOMATOM Definition 13908 2Siemens Introduces New Dual Energy Applications to SOMATOM Definition 13908 3Siemens Introduces New Dual Energy Applications to SOMATOM Definition 13908 4Caliper Life Sciences to Present at Cowen and Company 28th Annual Health Care Conference 3827 1UCF researchers discover a new protein family implicated in inflammatory diseases 13902 1UCF researchers discover a new protein family implicated in inflammatory diseases 13902 2First Ever National Board Certification 28R 29 for Americas Health Educators Arrives 13897 1First Ever National Board Certification 28R 29 for Americas Health Educators Arrives 13897 2First Ever National Board Certification 28R 29 for Americas Health Educators Arrives 13897 3
...d amphibian species at an accelerating rate in rec...etween 1992 and 2003. At the same time, amphibians...re rapidly than either mammals or birds, underscor... analysis published in the August 2005 issue of Bi...itute of Biological Sciences, indicates that, cont...
...ely dreaded disease in medieval Europe ?to fade fr... practically disappeared there. , The reason seem...of Jerusalem and in London, that tuberculosis, a f...millions throughout Europe. , Their conclusion is ...ns from the ancient and medieval periods in Israel...
...rovide some protection to the heart from injury ev...ck, Jefferson Medical College researchers report. ...ranslational Medicine in the Department of Medicin... University in Philadelphia, and his co-workers kn...the ischemic heart. Darbepoietin is a long-acting ...
...ferent rates, and the evolutionary line that produ...lt, according to a new study by scientists at the ...hat our species has retained characteristics of a ...quickly-evolving animals. This overturns a commonl...imals. The work appears in the current issue of th...
Other Biology News:New amphibian species result from exploration, not from rule changes 2Once-dreaded leprosy 'replaced' by tuberculosis, say researchers 2The earliest animals had human-like genes 2The earliest animals had human-like genes 3
(Date:10/9/2008)... for the best "gecko foot" dry adhesive got a new ...tical material reported in the journal Science by ... , Scientists have long been interested in the a...ng to ceilings by their toes. The creatures owe t...c hairs in their toes that take advantage of atomi...
(Date:10/9/2008)...y climbs to No. 2 in ranking; up six spots from la... -- Monsanto Company (NYSE:,MON) is earning recogn...s,ground-breaking products but also for being a gr.... Louis, Missouri, took second place in,the 2008 T... leading,industry publication. The company moved u...
(Date:10/9/2008)...mber 7 out of top 20 Employers Across Life Science.../ -- EMD Serono, Inc., an affiliate,of Merck KGaA,...een named,by Science magazine as a top employer in...ranking number 7 out of the top 20 employers,acros...ientific community has recognized EMD Serono,as a ...
(Date:10/9/2008)...ation and NCPA Join Forces to Deliver Patient Care...aPro(SM), RESTON, Va. and WASHINGTON, Oct. 9 /PRN...armacists Association (APhA) Foundation, the creat...r in the Asheville Project(R),jointly announced t...ll,deliver all of APhA Foundation,s HealthMapRx co...
Breaking Biology Technology:Dry adhesive based on carbon nanotubes gets stronger, with directional gripping ability 2Dry adhesive based on carbon nanotubes gets stronger, with directional gripping ability 3Dry adhesive based on carbon nanotubes gets stronger, with directional gripping ability 4Monsanto Recognized as Top Biotechnology Employer by Science Magazine 2EMD Serono Named as a Top Employer by Science Magazine 2Mirixa Corporation and the APhA Foundation Form Partnership 2Mirixa Corporation and the APhA Foundation Form Partnership 3
...adison, Wis. - Wisconsin high-school students ar...scoring well on the ACT , a major college prepare...point scale, Wisconsin ranked second nationally am...e-tenth of one percentage point behind first-place...T reflect the quality of Wisconsin,s schools, all ...
...waukee, Wis. - InvivoSciences LLC , a startup bi...s working to help drug developers bridge the gap b...esearchers studying heart diseases, skin disorders...issue system could provide that bridge. , ,Using t...eatured at a recent meeting of the Wisconsin Biot...
...waukee, Wis. - Wisconsin can create a dynamic, cr... cutting taxes and shedding its "welfare state" me...athering of business executives. , ,John Jazwiec, ...cized the state,s business climate, outlined what ...onomic Trends Breakfast of the Independent Busine...
... everyone has heard of identity theft (IDT), yet u...that they are at high risk. An alarming figure is ...r originate from a place of business, employer, or...federal government). , ,All entities and certain i...and state laws to implement measures, policies, pr...
Other Biology Technology:Wisconsin students test well on ACT, but relatively few are ready for college rigors 2Wisconsin students test well on ACT, but relatively few are ready for college rigors 3Biotech firm uses live heart tissue in drug screens 2Biotech firm uses live heart tissue in drug screens 3RedPrairie exec calls for 50 percent tax cut 2RedPrairie exec calls for 50 percent tax cut 3RedPrairie exec calls for 50 percent tax cut 4Identity theft: The business time bomb 2Identity theft: The business time bomb 3Identity theft: The business time bomb 4