Navigation Links
Mouse Anti-TOPORS Monoclonal Antibody, Unconjugated, Clone 4G4 from Abnova Corporation

ProductsMouse Anti-TOPORS Monoclonal Antibody, Unconjugated, Clone 4G4 from Abnova Corporation
Company Abnova Corporation
Item Mouse Anti-TOPORS Monoclonal Antibody, Unconjugated, Clone 4G4
Price 
Description Mouse monoclonal antibody raised against a partial recombinant TOPORS.
Immunogen: TOPORS (NP_005793, 98 a.a. ~ 206 a.a) partial recombinant protein with GST tag.
Accession Number: NM_005802
Protein Sequence: SPDSKCPICLDRFDNVSYLDRCLHKFCFRCVQEWSKNKAECPLCKQPFDSIFHSVRAEDDFKEYVLRPSYNGSFVTPDRRFRYRTTLTRERNASVYSPSGPVNRRTTT*
Info Abnova CorporationAbnova Corporation
Abnova Corporation (HQ)
9th Fl., No. 108, Jhouzih St.
Neihu District, Taipei
114 Taiwan R.O.C.
Tel: +886-2-8751-1888
Fax: +886-2-8751-1166

Abnova GmbH
Boxbergring 107
69126 Heidelberg
Germany
Tel: +49 6221 3632226
Fax: +49 6221 825878

Customer Service: +886-2-8751-1888
Fax Number: +886-2-8751-1166
Web Site: http://www.abnova.com.tw
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Mouse Anti-Amodiaquine Monoclonal Antibody, Unconjugated, Clone 6D10 from AntibodyShop A/S
2. Mouse Anti-Protein S Monoclonal Antibody, Unconjugated, Clone HYB 232-02 from Abcam
3. Mouse Anti-Mouse Glutathione S-transferase M1 (GSTM1) Monoclonal Antibody, Unconjugated from Lifespan Biosciences
4. Mouse Anti-Human S-100 alpha/beta chain Monoclonal Antibody, Unconjugated, Clone 8B10 from Santa Cruz Biotechnology, Inc.
5. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Testis from OriGene Technologies
6. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Brain (adult) from OriGene Technologies
7. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (12.5 - day) from OriGene Technologies
8. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (19 - day) from OriGene Technologies
9. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Thymus from OriGene Technologies
10. Mouse Anti-Human Complement factor B Monoclonal Antibody, Unconjugated, Clone 9B6 from AntibodyShop A/S
11. Mouse Anti-Human Choriongonadotropin (hCG) Monoclonal Antibody, Unconjugated, Clone 5F10 from AntibodyShop A/S
LIGHT DIAGNOSTICS Echovirus Blend Reagent, ~50 tests, included in kit #3340 & #3365...
Goat polyclonal to Rabenosyn 5 ( Abpromise for all tested applications). Antigen: Synthetic peptide: ELKHTLAKQKGGTD, corresponding to C terminal amino acids 771-784 of Human Rabenosyn 5. Entr...
TRIAL SIZE Anti-Kaede [2F4] Monoclonal Research Focus: tag Storage: -20C Shipping Temperature: 4C...
Phospho-C/EBPbeta (Thr235) Antibody...
Biology Products:
(Date:1/25/2016)...  Glencoe Software, the world-leading supplier of image data ... provide the data management solution OMERO Plus for the ... Photo - http://photos.prnewswire.com/prnh/20160125/325328LOGO ... Phenotypic analysis measures the characteristics and behavior of ... states such as health and disease, the presence or ...
(Date:1/20/2016)... 2016   MedNet Solutions , an innovative SaaS-based ... clinical research, is pleased to announce the attainment of ... the result of the company,s laser focus on (and ... , it,s comprehensive, easy-to-use and highly affordable cloud-based technology ... Key MedNet growth achievements in 2015 include: ...
(Date:1/13/2016)... DUBLIN , January 13, 2016 ... has announced the addition of the  ... - Estimation & Forecast (2015-2020)" ... http://www.researchandmarkets.com/research/7h6hnn/india_biometrics ) has announced the ... & Identification Market - Estimation & ...
Breaking Biology News(10 mins):
(Date:2/11/2016)... 2016  Neurocrine Biosciences, Inc. (NASDAQ: NBIX ) today announced ... 2015. --> --> For ... of $29.3 million, or $0.34 loss per share, compared to a ... the same period in 2014. For the year ended December 31, ... $1.05 loss per share, as compared to a net loss of ...
(Date:2/11/2016)... , Feb. 11, 2016  Wellcentive today ... Portland, Oregon -based community care ... provide population health analytics, quality reporting and care ... FamilyCare strengthen its team of quality managers, analysts ... to the provider groups serving FamilyCare members. ...
(Date:2/11/2016)... York (PRWEB) , ... February 11, 2016 , ... ... instruments for more than 150 years, continues today to pursue the highest level ... line of analytical instruments: the AR9 Refractometer and the AR5 Refractometer. Accurate, ...
(Date:2/10/2016)... 2016  The Maryland House of Delegates and House ... University of Maryland School of Medicine Dean E. ... Maryland Medical System President and CEO Robert Chrencik ... highest honor given to the public by the leader ... Reece and Mr. Chrencik for their contributions to ...
Breaking Biology Technology: