Navigation Links
Mouse Anti-TOPORS Monoclonal Antibody, Unconjugated, Clone 4G4 from Abnova Corporation

ProductsMouse Anti-TOPORS Monoclonal Antibody, Unconjugated, Clone 4G4 from Abnova Corporation
Company Abnova Corporation
Item Mouse Anti-TOPORS Monoclonal Antibody, Unconjugated, Clone 4G4
Price 
Description Mouse monoclonal antibody raised against a partial recombinant TOPORS.
Immunogen: TOPORS (NP_005793, 98 a.a. ~ 206 a.a) partial recombinant protein with GST tag.
Accession Number: NM_005802
Protein Sequence: SPDSKCPICLDRFDNVSYLDRCLHKFCFRCVQEWSKNKAECPLCKQPFDSIFHSVRAEDDFKEYVLRPSYNGSFVTPDRRFRYRTTLTRERNASVYSPSGPVNRRTTT*
Info Abnova CorporationAbnova Corporation
Abnova Corporation (HQ)
9th Fl., No. 108, Jhouzih St.
Neihu District, Taipei
114 Taiwan R.O.C.
Tel: +886-2-8751-1888
Fax: +886-2-8751-1166

Abnova GmbH
Boxbergring 107
69126 Heidelberg
Germany
Tel: +49 6221 3632226
Fax: +49 6221 825878

Customer Service: +886-2-8751-1888
Fax Number: +886-2-8751-1166
Web Site: http://www.abnova.com.tw
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Mouse Anti-Amodiaquine Monoclonal Antibody, Unconjugated, Clone 6D10 from AntibodyShop A/S
2. Mouse Anti-Protein S Monoclonal Antibody, Unconjugated, Clone HYB 232-02 from Abcam
3. Mouse Anti-Mouse Glutathione S-transferase M1 (GSTM1) Monoclonal Antibody, Unconjugated from Lifespan Biosciences
4. Mouse Anti-Human S-100 alpha/beta chain Monoclonal Antibody, Unconjugated, Clone 8B10 from Santa Cruz Biotechnology, Inc.
5. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Testis from OriGene Technologies
6. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Brain (adult) from OriGene Technologies
7. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (12.5 - day) from OriGene Technologies
8. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (19 - day) from OriGene Technologies
9. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Thymus from OriGene Technologies
10. Mouse Anti-Human Complement factor B Monoclonal Antibody, Unconjugated, Clone 9B6 from AntibodyShop A/S
11. Mouse Anti-Human Choriongonadotropin (hCG) Monoclonal Antibody, Unconjugated, Clone 5F10 from AntibodyShop A/S
... EZ-Tn5™ Plasmid-Based Deletion Machine is based on ... system developed by Goryshin and Reznikoff, and ... nested families of deletions and inversions by ... a transposon-containing plasmid vector. Although most researchers ...
High affinity antibodies recognizes HSP70 protein from human cardiac tissue. Could be used for Westerb blotting application, ELISA....
... or alter genes on the E.coli ... allows the exchange of genetic information in a ... FRT-flanked kanamycin resistance marker cassette is supplied with ... a gene on the E.coli chromosome. ...
The VersArray hybridization chamber is used for manual (coverslip) hybridization of microarrays. The chamber accommodates 2 slides and is watertight to allow incubation of slides in a water bath. Dim...
Biology Products:
(Date:4/20/2014)... a gift of germsgerms that help to kick-start ... fend off infection, may paradoxically interrupt a newborn,s ... susceptible to dangerous pathogens. , A new ... Hospital of Philadelphia (CHOP) sheds light on immunology ... a crucial role in fostering the rapid production ...
(Date:4/18/2014)... Protecting wildlife while feeding a world population predicted ... a holistic approach to conservation that considers human-altered ... , Wildlife and the natural habitat that supports ... a world where at least three-quarters of the ... the rest is vulnerable to human-caused impacts such ...
(Date:4/18/2014)... A team of researchers led by a University ... to receive a $7.5 million Department of Defense grant ... basic scientific foundations for the predictable design of light-weight, ... diversity of structures from plants and animals, including the ... what biological systems have constructed over millions of years ...
Breaking Biology News(10 mins):Study of gut microbes, antibiotics: Clues to improving immunity in premature infants 2Stanford researchers rethink 'natural' habitat for wildlife 2Stanford researchers rethink 'natural' habitat for wildlife 3Stanford researchers rethink 'natural' habitat for wildlife 4Mantis shrimp, toucan and trilobite, oh my 2Mantis shrimp, toucan and trilobite, oh my 3
... new study suggests that consuming olive oil may help prevent ... the June 15, 2011, online issue of Neurology, ... "Our research suggests that a new set of dietary ... and older," said study author Ccilia Samieri, PhD, with the ...
... long-term study verifies multi-paddock grazing improves vegetation, soil ... in large-scale ranches, according to Texas AgriLife Research ... vegetation and soils achieved by commercial ranchers who ... circumstances to achieve desirable outcomes, said Dr. Richard ...
... Alto, CA Although scientists have been able to sequence ... context for associating the proteins encoded in genes with ... plant physiology and ecologyespecially in regard to photosynthesisa team ... of proteins encoded in the genomes of plants and ...
Cached Biology News:Using olive oil in your diet may prevent a stroke 2AgriLife research: Multi-paddock grazing is superior to continuous grazing 2AgriLife research: Multi-paddock grazing is superior to continuous grazing 3AgriLife research: Multi-paddock grazing is superior to continuous grazing 4What makes a plant a plant? 2
(Date:1/15/2014)... A study has been launched to test ... track could help to tackle the problem of obesity.  This ... GP surgery based in Stowmarket) and academics at University Campus ... Telemetry technology, which is inspired by equipment used to collect ...
(Date:1/15/2014)... 2014 Two champions of science, technology, ... of an annual competition for middle and high school ... innovative STEM study. The competition presents students with real-world ... Engineering Aptitude, Mathematics, and Sciences is a program ...
(Date:1/15/2014)... 2014 DTS Language Services, Inc . ... Portal for Life Science organizations who need document translations. ... matter of their documents in advance with a selection of ... of translations, often a critical factor in clinical and scientific ...
(Date:1/15/2014)... Freeslate, Inc ., the leading provider of ... one of India’s top five pharmaceutical companies, has received ... for high throughput solid form screening. , Lupin, ... range of quality, affordable generic and branded formulations and ...
Breaking Biology Technology:Formula 1 Technology Tackles Obesity in Unique Healthcare Partnership 2Formula 1 Technology Tackles Obesity in Unique Healthcare Partnership 3Formula 1 Technology Tackles Obesity in Unique Healthcare Partnership 4Technology Student Association Partners with Leaders in STEM Education Advocacy for Annual Competition 2Technology Student Association Partners with Leaders in STEM Education Advocacy for Annual Competition 3Technology Student Association Partners with Leaders in STEM Education Advocacy for Annual Competition 4Technology Student Association Partners with Leaders in STEM Education Advocacy for Annual Competition 5DTS Improves Efficiency for Life Science Document Translations 2Lupin Selects Freeslate’s CM Protégé PharmD System to Accelerate Polymorph Screening for Drug Development 2Lupin Selects Freeslate’s CM Protégé PharmD System to Accelerate Polymorph Screening for Drug Development 3