Navigation Links
Mouse Anti-TOPORS Monoclonal Antibody, Unconjugated, Clone 4G4 from Abnova Corporation

ProductsMouse Anti-TOPORS Monoclonal Antibody, Unconjugated, Clone 4G4 from Abnova Corporation
Company Abnova Corporation
Item Mouse Anti-TOPORS Monoclonal Antibody, Unconjugated, Clone 4G4
Price 
Description Mouse monoclonal antibody raised against a partial recombinant TOPORS.
Immunogen: TOPORS (NP_005793, 98 a.a. ~ 206 a.a) partial recombinant protein with GST tag.
Accession Number: NM_005802
Protein Sequence: SPDSKCPICLDRFDNVSYLDRCLHKFCFRCVQEWSKNKAECPLCKQPFDSIFHSVRAEDDFKEYVLRPSYNGSFVTPDRRFRYRTTLTRERNASVYSPSGPVNRRTTT*
Info Abnova CorporationAbnova Corporation
Abnova Corporation (HQ)
9th Fl., No. 108, Jhouzih St.
Neihu District, Taipei
114 Taiwan R.O.C.
Tel: +886-2-8751-1888
Fax: +886-2-8751-1166

Abnova GmbH
Boxbergring 107
69126 Heidelberg
Germany
Tel: +49 6221 3632226
Fax: +49 6221 825878

Customer Service: +886-2-8751-1888
Fax Number: +886-2-8751-1166
Web Site: http://www.abnova.com.tw
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Mouse Anti-Amodiaquine Monoclonal Antibody, Unconjugated, Clone 6D10 from AntibodyShop A/S
2. Mouse Anti-Protein S Monoclonal Antibody, Unconjugated, Clone HYB 232-02 from Abcam
3. Mouse Anti-Mouse Glutathione S-transferase M1 (GSTM1) Monoclonal Antibody, Unconjugated from Lifespan Biosciences
4. Mouse Anti-Human S-100 alpha/beta chain Monoclonal Antibody, Unconjugated, Clone 8B10 from Santa Cruz Biotechnology, Inc.
5. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Testis from OriGene Technologies
6. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Brain (adult) from OriGene Technologies
7. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (12.5 - day) from OriGene Technologies
8. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (19 - day) from OriGene Technologies
9. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Thymus from OriGene Technologies
10. Mouse Anti-Human Complement factor B Monoclonal Antibody, Unconjugated, Clone 9B6 from AntibodyShop A/S
11. Mouse Anti-Human Choriongonadotropin (hCG) Monoclonal Antibody, Unconjugated, Clone 5F10 from AntibodyShop A/S
... 192 ) The antibody is preadsorbed to remove ... antibody buffered aqueous glycerol solution A ... Mg 2+ and Ca 2+ ), pH ... BSA (IgG, protease free) and 0.05% sodium azide ...
... Guava EasyCyte system is the first and ... built-in 96-well microplate sampling (with tube options). ... and compounds quickly and easily, without the ... the carryover issues found with other detachable ...
Methylation analysis of gene promoters using bilsulfite treatment of DNA and comparative DNA sequence analysis. Probe design and PCR included....
... Facility , Galaxy LIMS, Sophisticated Bioinformatics , ... scientists ,We offer individual sample sequencing of ... for single or double strand publication quality. ... DNA of interest is 1.3 to 7 ...
Biology Products:
(Date:4/13/2017)... , April 13, 2017 According to a ... Identity Authentication, Identity Analytics, Identity Administration, and Authorization), Service, Authentication Type, Deployment ... the IAM Market is expected to grow from USD 14.30 Billion in ... Rate (CAGR) of 17.3%. ... MarketsandMarkets Logo ...
(Date:4/6/2017)... , April 6, 2017 ... RFID, ANPR, Document Readers, by End-Use (Transportation & Logistics, ... Facility, Oil, Gas & Fossil Generation Facility, Nuclear Power), ... Educational, Other) Are you looking for a ... sector? ...
(Date:4/3/2017)... , April 3, 2017  Data captured ... engineering platform, detected a statistically significant association ... prior to treatment and objective response of ... potential to predict whether cancer patients will ... treatment, as well as to improve both pre-infusion ...
Breaking Biology News(10 mins):
(Date:4/21/2017)... ... April 21, 2017 , ... Having worked on the design ... is pleased to introduce it to top lab design architects from around the country ... and VP of Industrial Design and Engineering Greg Casey will be at the show, ...
(Date:4/21/2017)... ... April 21, 2017 , ... The impressively wide ... of researchers, engineers, product developers, and industry suppliers gathered last week for ... SPIE, the international society for optics and photonics , the event drew nearly ...
(Date:4/21/2017)... ... April 21, 2017 , ... Frederick Innovative ... range of emerging bio and technology start-ups, is hosting “Celebration Friday” (a festive ... event will start with libations and networking at 3:30 p.m. at FITCI’s 4539 ...
(Date:4/20/2017)... ... April 20, 2017 , ... ... this new webinar will explore challenging patient cases when screening for direct oral ... there may be a need for bridging parental anticoagulation especially for those at ...
Breaking Biology Technology: