Navigation Links
Mouse Anti-TOPORS Monoclonal Antibody, Unconjugated, Clone 4G4 from Abnova Corporation

ProductsMouse Anti-TOPORS Monoclonal Antibody, Unconjugated, Clone 4G4 from Abnova Corporation
Company Abnova Corporation
Item Mouse Anti-TOPORS Monoclonal Antibody, Unconjugated, Clone 4G4
Price 
Description Mouse monoclonal antibody raised against a partial recombinant TOPORS.
Immunogen: TOPORS (NP_005793, 98 a.a. ~ 206 a.a) partial recombinant protein with GST tag.
Accession Number: NM_005802
Protein Sequence: SPDSKCPICLDRFDNVSYLDRCLHKFCFRCVQEWSKNKAECPLCKQPFDSIFHSVRAEDDFKEYVLRPSYNGSFVTPDRRFRYRTTLTRERNASVYSPSGPVNRRTTT*
Info Abnova CorporationAbnova Corporation
Abnova Corporation (HQ)
9th Fl., No. 108, Jhouzih St.
Neihu District, Taipei
114 Taiwan R.O.C.
Tel: +886-2-8751-1888
Fax: +886-2-8751-1166

Abnova GmbH
Boxbergring 107
69126 Heidelberg
Germany
Tel: +49 6221 3632226
Fax: +49 6221 825878

Customer Service: +886-2-8751-1888
Fax Number: +886-2-8751-1166
Web Site: http://www.abnova.com.tw
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Mouse Anti-Amodiaquine Monoclonal Antibody, Unconjugated, Clone 6D10 from AntibodyShop A/S
2. Mouse Anti-Protein S Monoclonal Antibody, Unconjugated, Clone HYB 232-02 from Abcam
3. Mouse Anti-Mouse Glutathione S-transferase M1 (GSTM1) Monoclonal Antibody, Unconjugated from Lifespan Biosciences
4. Mouse Anti-Human S-100 alpha/beta chain Monoclonal Antibody, Unconjugated, Clone 8B10 from Santa Cruz Biotechnology, Inc.
5. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Testis from OriGene Technologies
6. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Brain (adult) from OriGene Technologies
7. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (12.5 - day) from OriGene Technologies
8. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (19 - day) from OriGene Technologies
9. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Thymus from OriGene Technologies
10. Mouse Anti-Human Complement factor B Monoclonal Antibody, Unconjugated, Clone 9B6 from AntibodyShop A/S
11. Mouse Anti-Human Choriongonadotropin (hCG) Monoclonal Antibody, Unconjugated, Clone 5F10 from AntibodyShop A/S
... background ,This solution greatly enhances antigen-antibody reactions, ... obtained with conventional methods. ,Two kinds of ... antibodies, which can suppress the background and ... versatility ,It is applicable to various assay ...
Chicken Anti-Human Stomatin-like 2 (STOML2 Polyclonal AntibodyNew Applications: ELISA, Western Blot...
Anti-Chicken IgY, (IgG) F(ab')2 Fragment Specific....
... Mouse anti-Cytohesin 2, Monoclonal Antibody, Unconjugated ... an assay dependent dilution. ICC: Use at an ... of 5 - 10 ug/ml, this concentration is ... Predicted molecular weight: 40 kDa. Not tested in ...
Biology Products:
(Date:4/15/2016)... Research and Markets has announced ... 2016-2020,"  report to their offering.  , ... global gait biometrics market is expected to grow ... 2016-2020. Gait analysis generates multiple variables ... to compute factors that are not or cannot ...
(Date:3/31/2016)... 2016  Genomics firm Nabsys has completed a financial ... Bready , M.D., who returned to the company in ... leadership team, including Chief Technology Officer, John Oliver ... Nurnberg and Vice President of Software and Informatics, ... Dr. Bready served as CEO of Nabsys from ...
(Date:3/22/2016)... Ontario , PROVO and ... Newborn Screening Ontario (NSO), which operates the ... for molecular testing, and Tute Genomics and UNIConnect, ... management technology respectively, today announced the launch of a ... next-generation sequencing (NGS) testing panel. NSO ...
Breaking Biology News(10 mins):
(Date:5/2/2016)... ... 2016 , ... StarNet Communications Corp, ( http://www.starnet.com/ ) a leading publisher of ... Desktop modules to its flagship X-Win32 PC X server. The new modules enable ... user’s PC over encrypted SSH. , Traditionally, users of PC X servers deploy the ...
(Date:4/29/2016)... New York , April 29, 2016 /PRNewswire/ ... report published by Transparency Market Research "Separation Systems ... Size, Share, Growth, Trends, and Forecast 2015 - ... was valued at US$ 10,665.5 Mn in 2014 ... of 6.8% from 2015 to 2023 to reach ...
(Date:4/28/2016)... The report "Cryocooler Market by ... (Technical Support, Product Repairs & Refurbishment, Preventive Maintenance, and ... 2022", published by MarketsandMarkets, the global market is expected ... a CAGR of 7.29% between 2016 and 2022. ... Figures spread through 159 Pages and in-depth TOC on ...
(Date:4/28/2016)... Windsor, Connecticut (PRWEB) , ... April 28, 2016 ... ... Morris Group, Inc., will hold an open house for regional manufacturers at its ... and displays from Tsugami, Okuma, Hardinge Group, Chiron and Trumpf. Almost 20 ...
Breaking Biology Technology: