Navigation Links
Mouse Anti-TOPORS Monoclonal Antibody, Unconjugated, Clone 4G4 from Abnova Corporation

ProductsMouse Anti-TOPORS Monoclonal Antibody, Unconjugated, Clone 4G4 from Abnova Corporation
Company Abnova Corporation
Item Mouse Anti-TOPORS Monoclonal Antibody, Unconjugated, Clone 4G4
Price 
Description Mouse monoclonal antibody raised against a partial recombinant TOPORS.
Immunogen: TOPORS (NP_005793, 98 a.a. ~ 206 a.a) partial recombinant protein with GST tag.
Accession Number: NM_005802
Protein Sequence: SPDSKCPICLDRFDNVSYLDRCLHKFCFRCVQEWSKNKAECPLCKQPFDSIFHSVRAEDDFKEYVLRPSYNGSFVTPDRRFRYRTTLTRERNASVYSPSGPVNRRTTT*
Info Abnova CorporationAbnova Corporation
Abnova Corporation (HQ)
9th Fl., No. 108, Jhouzih St.
Neihu District, Taipei
114 Taiwan R.O.C.
Tel: +886-2-8751-1888
Fax: +886-2-8751-1166

Abnova GmbH
Boxbergring 107
69126 Heidelberg
Germany
Tel: +49 6221 3632226
Fax: +49 6221 825878

Customer Service: +886-2-8751-1888
Fax Number: +886-2-8751-1166
Web Site: http://www.abnova.com.tw
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Mouse Anti-Amodiaquine Monoclonal Antibody, Unconjugated, Clone 6D10 from AntibodyShop A/S
2. Mouse Anti-Protein S Monoclonal Antibody, Unconjugated, Clone HYB 232-02 from Abcam
3. Mouse Anti-Mouse Glutathione S-transferase M1 (GSTM1) Monoclonal Antibody, Unconjugated from Lifespan Biosciences
4. Mouse Anti-Human S-100 alpha/beta chain Monoclonal Antibody, Unconjugated, Clone 8B10 from Santa Cruz Biotechnology, Inc.
5. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Testis from OriGene Technologies
6. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Brain (adult) from OriGene Technologies
7. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (12.5 - day) from OriGene Technologies
8. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (19 - day) from OriGene Technologies
9. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Thymus from OriGene Technologies
10. Mouse Anti-Human Complement factor B Monoclonal Antibody, Unconjugated, Clone 9B6 from AntibodyShop A/S
11. Mouse Anti-Human Choriongonadotropin (hCG) Monoclonal Antibody, Unconjugated, Clone 5F10 from AntibodyShop A/S
... gene in baculoviral expression vector, transfection ... purification of ten clones, generation of ... clone, protein expression and tag purification ... yield and timeline: 1-4 mg of ...
Request Info...
Kit containing positive control DNA all parts of the HIV-1 genome, HIV-1 negative control DNA, Primers SK38, SK39, SK19...
Contains 0.2 g/L EDTA4Na in phosphate-buffered saline....
Biology Products:
(Date:6/14/2017)... (NYSE: IBM ) is introducing several innovative partner startups ... collaboration between startups and global businesses, taking place in ... nine startups will showcase the solutions they have built with ... France is one of the ... percent increase in the number of startups created between 2012 ...
(Date:5/6/2017)... , May 5, 2017 RAM ... announced a new breakthrough in biometric authentication based ... quantum mechanical properties to perform biometric authentication. These new ... semiconductor material created by Ram Group and its ... entertainment, transportation, supply chains and security. Ram Group ...
(Date:4/17/2017)... April 17, 2017 NXT-ID, Inc. (NASDAQ: ... the filing of its 2016 Annual Report on Form 10-K on ... ... is available in the Investor Relations section of the Company,s website ... SEC,s website at http://www.sec.gov . 2016 Year Highlights: ...
Breaking Biology News(10 mins):
(Date:7/20/2017)... Fayetteville, AR (PRWEB) , ... July 20, 2017 , ... ... (Jamie) Rogers is joining the company’s board of directors. This addition continues to ... VIC board," said Calvin Goforth, CEO and Chairman. “He is a highly accomplished business ...
(Date:7/20/2017)... ... July 20, 2017 , ... Corporate Directors Forum is recognizing six ... Director of the Year Awards. , The awards will be presented Thursday, September 7th, ... event celebrates directors who have made significantly positive contributions in the boardrooms of some ...
(Date:7/18/2017)... ... 2017 , ... Sourcing custom glass or quartz parts can be a daunting ... properly execute your job can take many hours of emails, phone calls and on-line ... to showcase the company’s capabilities and core custom categories, and enables you to start ...
(Date:7/18/2017)... , ... July 18, 2017 , ... Blood centers traditionally ... across the region. Nationally, summer is a struggle for community blood centers as high ... San Antonio Chamber of Commerce is teaming up with the South ...
Breaking Biology Technology: