Navigation Links
Mouse Anti-TOPORS Monoclonal Antibody, Unconjugated, Clone 4G4 from Abnova Corporation

ProductsMouse Anti-TOPORS Monoclonal Antibody, Unconjugated, Clone 4G4 from Abnova Corporation
Company Abnova Corporation
Item Mouse Anti-TOPORS Monoclonal Antibody, Unconjugated, Clone 4G4
Price 
Description Mouse monoclonal antibody raised against a partial recombinant TOPORS.
Immunogen: TOPORS (NP_005793, 98 a.a. ~ 206 a.a) partial recombinant protein with GST tag.
Accession Number: NM_005802
Protein Sequence: SPDSKCPICLDRFDNVSYLDRCLHKFCFRCVQEWSKNKAECPLCKQPFDSIFHSVRAEDDFKEYVLRPSYNGSFVTPDRRFRYRTTLTRERNASVYSPSGPVNRRTTT*
Info Abnova CorporationAbnova Corporation
Abnova Corporation (HQ)
9th Fl., No. 108, Jhouzih St.
Neihu District, Taipei
114 Taiwan R.O.C.
Tel: +886-2-8751-1888
Fax: +886-2-8751-1166

Abnova GmbH
Boxbergring 107
69126 Heidelberg
Germany
Tel: +49 6221 3632226
Fax: +49 6221 825878

Customer Service: +886-2-8751-1888
Fax Number: +886-2-8751-1166
Web Site: http://www.abnova.com.tw
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Mouse Anti-Amodiaquine Monoclonal Antibody, Unconjugated, Clone 6D10 from AntibodyShop A/S
2. Mouse Anti-Protein S Monoclonal Antibody, Unconjugated, Clone HYB 232-02 from Abcam
3. Mouse Anti-Mouse Glutathione S-transferase M1 (GSTM1) Monoclonal Antibody, Unconjugated from Lifespan Biosciences
4. Mouse Anti-Human S-100 alpha/beta chain Monoclonal Antibody, Unconjugated, Clone 8B10 from Santa Cruz Biotechnology, Inc.
5. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Testis from OriGene Technologies
6. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Brain (adult) from OriGene Technologies
7. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (12.5 - day) from OriGene Technologies
8. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (19 - day) from OriGene Technologies
9. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Thymus from OriGene Technologies
10. Mouse Anti-Human Complement factor B Monoclonal Antibody, Unconjugated, Clone 9B6 from AntibodyShop A/S
11. Mouse Anti-Human Choriongonadotropin (hCG) Monoclonal Antibody, Unconjugated, Clone 5F10 from AntibodyShop A/S
... miRCURY Array LNA microarray slides ... Array microarray slides incorporate Exiqons unique Locked ... sensitivity and excellent mismatch discrimination for short ... on less than 1 g total RNA ...
... Clear amber to slightly cloudy liquid. ... vials per set, each containing 10 ... in the following proportions by weight: ... (mannide monooleate emulsifier), and 0.1% ...
With sodium bicarbonate. Sterile, Cell culture tested...
For removal of the zona pellucida. Sterile, Mouse Embryo tested...
Biology Products:
(Date:11/29/2016)... 2016 BioDirection, a privately held medical device ... objective detection of concussion and other traumatic brain injury ... a meeting with the U.S. Food and Drug Administration ... Package. During the meeting company representatives reviewed plans for ... to commencement of a planned pilot trial. ...
(Date:11/29/2016)... France , November 29, 2016 Nearly one ... Continue Reading ... ... is part of an efficient Identity Management. (PRNewsFoto/DERMALOG Identification Systems) ... DERMALOG is Germany's largest Multi-Biometric supplier: ...
(Date:11/24/2016)... 2016 Cercacor today introduced Ember TM ... non-invasively measure hemoglobin, Oxygen Content, Oxygen Saturation, ... Rate in approximately 30 seconds. Smaller than a smartphone, ... access to key data about their bodies to help ... Hemoglobin carries oxygen to muscles. When ...
Breaking Biology News(10 mins):
(Date:12/5/2016)... 2016  Renova™ Therapeutics, a biotechnology company developing ... other chronic diseases, announced that Catherine Bovenizer ... Financial Officer (CFO), effective today. Ms. ... experience in financial management for a variety of ... Most recently, Ms. Bovenizer was the Vice President ...
(Date:12/5/2016)... Dec. 5, 2016 NxGen MDx announced today that it brought ... in house, we,ve been able to improve customer service through shortened turnaround ... Alan Mack , CEO of NxGen MDx. ... , , A decrease in ... led to more job opportunities at the Grand Rapid headquarters. ...
(Date:12/5/2016)... 2016 Research and Markets has announced ... - Technologies, Markets and Companies" to their offering. ... , , ... of human genome variations, development of sequencing technologies, and their ... as companies developing them. Various applications of sequencing are described ...
(Date:12/4/2016)... ... December 02, 2016 , ... A ... small businesses in federally funded research and development is welcome news for the ... and photonics . , As part of the National Defense Authorization Act (NDAA) ...
Breaking Biology Technology: