Navigation Links
Mouse Anti-TOPORS Monoclonal Antibody, Unconjugated, Clone 4G4 from Abnova Corporation

ProductsMouse Anti-TOPORS Monoclonal Antibody, Unconjugated, Clone 4G4 from Abnova Corporation
Company Abnova Corporation
Item Mouse Anti-TOPORS Monoclonal Antibody, Unconjugated, Clone 4G4
Price 
Description Mouse monoclonal antibody raised against a partial recombinant TOPORS.
Immunogen: TOPORS (NP_005793, 98 a.a. ~ 206 a.a) partial recombinant protein with GST tag.
Accession Number: NM_005802
Protein Sequence: SPDSKCPICLDRFDNVSYLDRCLHKFCFRCVQEWSKNKAECPLCKQPFDSIFHSVRAEDDFKEYVLRPSYNGSFVTPDRRFRYRTTLTRERNASVYSPSGPVNRRTTT*
Info Abnova CorporationAbnova Corporation
Abnova Corporation (HQ)
9th Fl., No. 108, Jhouzih St.
Neihu District, Taipei
114 Taiwan R.O.C.
Tel: +886-2-8751-1888
Fax: +886-2-8751-1166

Abnova GmbH
Boxbergring 107
69126 Heidelberg
Germany
Tel: +49 6221 3632226
Fax: +49 6221 825878

Customer Service: +886-2-8751-1888
Fax Number: +886-2-8751-1166
Web Site: http://www.abnova.com.tw
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Mouse Anti-Amodiaquine Monoclonal Antibody, Unconjugated, Clone 6D10 from AntibodyShop A/S
2. Mouse Anti-Protein S Monoclonal Antibody, Unconjugated, Clone HYB 232-02 from Abcam
3. Mouse Anti-Mouse Glutathione S-transferase M1 (GSTM1) Monoclonal Antibody, Unconjugated from Lifespan Biosciences
4. Mouse Anti-Human S-100 alpha/beta chain Monoclonal Antibody, Unconjugated, Clone 8B10 from Santa Cruz Biotechnology, Inc.
5. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Testis from OriGene Technologies
6. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Brain (adult) from OriGene Technologies
7. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (12.5 - day) from OriGene Technologies
8. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (19 - day) from OriGene Technologies
9. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Thymus from OriGene Technologies
10. Mouse Anti-Human Complement factor B Monoclonal Antibody, Unconjugated, Clone 9B6 from AntibodyShop A/S
11. Mouse Anti-Human Choriongonadotropin (hCG) Monoclonal Antibody, Unconjugated, Clone 5F10 from AntibodyShop A/S
Recommend to use at up to 5000X dilutions for cell culture (e.g. Add 1 ul to 1 ml of culture medium.)...
Prepared in distilled water....
... [14C] Methylated Protein Molecular Weight Markers, 37 ... enable molecular weight determination of the sample ... visual monitoring of band migration in the ... of the [14C] version without Rainbow-labeling is ...
in vitro Translation, Accessory Products...
Biology Products:
(Date:1/30/2017)... FRANCISCO , Jan. 30, 2017   Invitae ... the fastest growing genetic information companies, today announced that ... financial results and provide 2017 guidance on Monday, February ... conference call that day at 4:45 p.m. Eastern / ... Invitae,s management team will briefly review financial results, guidance, ...
(Date:1/24/2017)... YORK , Jan. 24, 2017 ... study of the laboratory use of nuclear magnetic ... 363 experienced end-users and profiled current practices, developments, ... years, as well as growth and opportunities. These ... Instrument suppliers, NMR instruments, needs and innovation requirements, ...
(Date:1/19/2017)... January 19, 2017 According to a new report published ... 2014 - 2022," the global biometric sensor market is expected to garner $1.5 ... In 2015, Asia-Pacific dominated the global market and contributed ... Continue Reading ... ...
Breaking Biology News(10 mins):
(Date:2/20/2017)... (PRWEB) , ... February 20, 2017 , ... ... in patients with catheters associated with peritoneal dialysis, announced today that it has ... dialysis catheter connection system in Peritoneal Dialysis International (PDI), the official Journal ...
(Date:2/18/2017)... -- Kurzlehrgang mit Fokus auf Assay ... legt metaproteomische Analyse des Darm-Mikrobioms bei Säuglingen dar   ... ... Yoav Peretz , Scientific Director bei ImmuneCarta, einen Kurzlehrgang ... Nachweis intrazellulärer Zytokine bei adoptiven Zelltherapie-Studien im Rahmen der ...
(Date:2/17/2017)... FREMONT, Calif. , Feb. 17, 2017 /PRNewswire/ ... pleased to announce development of a novel system ... in collaboration with the University of Rochester (NY, ... ). The new system is able to ... cancer biomarker, HER2 (Human epidermal growth factor receptor-2) ...
(Date:2/16/2017)... Arbor, MI (PRWEB) , ... February 16, 2017 , ... ... 5:00-7:00 p.m. The event will be held at Avomeen Analytical Services (4840 Venture ... by a MichBio member organization. They provide an opportunity to interact with peers, make ...
Breaking Biology Technology: