Navigation Links
Mouse Anti-TOPORS Monoclonal Antibody, Unconjugated, Clone 4G4 from Abnova Corporation

ProductsMouse Anti-TOPORS Monoclonal Antibody, Unconjugated, Clone 4G4 from Abnova Corporation
Company Abnova Corporation
Item Mouse Anti-TOPORS Monoclonal Antibody, Unconjugated, Clone 4G4
Price 
Description Mouse monoclonal antibody raised against a partial recombinant TOPORS.
Immunogen: TOPORS (NP_005793, 98 a.a. ~ 206 a.a) partial recombinant protein with GST tag.
Accession Number: NM_005802
Protein Sequence: SPDSKCPICLDRFDNVSYLDRCLHKFCFRCVQEWSKNKAECPLCKQPFDSIFHSVRAEDDFKEYVLRPSYNGSFVTPDRRFRYRTTLTRERNASVYSPSGPVNRRTTT*
Info Abnova CorporationAbnova Corporation
Abnova Corporation (HQ)
9th Fl., No. 108, Jhouzih St.
Neihu District, Taipei
114 Taiwan R.O.C.
Tel: +886-2-8751-1888
Fax: +886-2-8751-1166

Abnova GmbH
Boxbergring 107
69126 Heidelberg
Germany
Tel: +49 6221 3632226
Fax: +49 6221 825878

Customer Service: +886-2-8751-1888
Fax Number: +886-2-8751-1166
Web Site: http://www.abnova.com.tw
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Mouse Anti-Amodiaquine Monoclonal Antibody, Unconjugated, Clone 6D10 from AntibodyShop A/S
2. Mouse Anti-Protein S Monoclonal Antibody, Unconjugated, Clone HYB 232-02 from Abcam
3. Mouse Anti-Mouse Glutathione S-transferase M1 (GSTM1) Monoclonal Antibody, Unconjugated from Lifespan Biosciences
4. Mouse Anti-Human S-100 alpha/beta chain Monoclonal Antibody, Unconjugated, Clone 8B10 from Santa Cruz Biotechnology, Inc.
5. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Testis from OriGene Technologies
6. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Brain (adult) from OriGene Technologies
7. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (12.5 - day) from OriGene Technologies
8. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (19 - day) from OriGene Technologies
9. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Thymus from OriGene Technologies
10. Mouse Anti-Human Complement factor B Monoclonal Antibody, Unconjugated, Clone 9B6 from AntibodyShop A/S
11. Mouse Anti-Human Choriongonadotropin (hCG) Monoclonal Antibody, Unconjugated, Clone 5F10 from AntibodyShop A/S
delta-like 1 homolog (Drosophila)...
ELISpot kit for human Granzyme B. Kits contain PVDF plates, capture & detection antibodies, streptavidin-ALP, BSA, Skimmed dry milk, BCIP/NTB substrate, and wash buffer...
SHEEP ANTI ECHIS OCCELATUS (VENOM)...
MOUSE ANTI RAT KAPPA/LAMBDA:HRP Immunogen: MARK-1: Rat kappa light chains (IR202 and IR968)MARL-15: Rat lambda light chains (RH58, IR31)...
Biology Products:
(Date:3/10/2016)... --> --> ... and Access Management Market by Component (Provisioning, Directory Services, ... Organization Size, by Deployment, by Vertical, and by Region ... market is estimated to grow from USD 7.20 Billion ... a Compound Annual Growth Rate (CAGR) of 12.2% during ...
(Date:3/9/2016)... Nigeria . Recently, ... 23,000 public service employees either did not exist with ... unlawfully.    --> Nigeria . ... than 23,000 public service employees either did not exist ... salary unlawfully.    --> DERMALOG, the biometrics ...
(Date:3/3/2016)... , March 3, 2016  FlexTech, a SEMI ... categories of Innovation, Research & Development, Leadership in Education, ... This is the 9 th year of the ... of companies and individuals from past years . ... on a pre-described set of criteria, by a panel ...
Breaking Biology News(10 mins):
(Date:5/31/2016)... ... 31, 2016 , ... The Academy of Model Aeronautics is thrilled to announce ... Memorial Day through Labor Day 2016. Bill Chaffee’s Boeing P-12B will be exhibited thanks ... Chaffee won first place for Senior Scale Model at the 1930 National Airplane Model ...
(Date:5/27/2016)... ... May 27, 2016 , ... PBI-Gordon Corporation is pleased to announce Dave ... In his 15-year career with PBI-Gordon, Dave has served in a wide variety of ... in the development and launch of many of PBI-Gordon’s most successful products. , “Dave ...
(Date:5/27/2016)... 27, 2016 At present, the Biotech ... this space know that volatility is what makes this industry ... ActiveWallSt.com: Synta Pharmaceuticals Corp. (NASDAQ: SNTA ), CTI ... LPTN ), and Heat Biologics Inc. (NASDAQ: ... the technical alerts for these stocks at: ...
(Date:5/26/2016)... 26, 2016 Q BioMed Inc. (OTCQB: ... be a featured presenter at the 5th Annual Marcum MicroCap ... York City at the Grand Hyatt Hotel. ... BioMed Inc. CEO, is scheduled to begin at 11a.m ET ... business strategy, recent developments and outline milestones for the balance ...
Breaking Biology Technology: