Navigation Links
Mouse Anti-TOPORS Monoclonal Antibody, Unconjugated, Clone 4G4 from Abnova Corporation

ProductsMouse Anti-TOPORS Monoclonal Antibody, Unconjugated, Clone 4G4 from Abnova Corporation
Company Abnova Corporation
Item Mouse Anti-TOPORS Monoclonal Antibody, Unconjugated, Clone 4G4
Price 
Description Mouse monoclonal antibody raised against a partial recombinant TOPORS.
Immunogen: TOPORS (NP_005793, 98 a.a. ~ 206 a.a) partial recombinant protein with GST tag.
Accession Number: NM_005802
Protein Sequence: SPDSKCPICLDRFDNVSYLDRCLHKFCFRCVQEWSKNKAECPLCKQPFDSIFHSVRAEDDFKEYVLRPSYNGSFVTPDRRFRYRTTLTRERNASVYSPSGPVNRRTTT*
Info Abnova CorporationAbnova Corporation
Abnova Corporation (HQ)
9th Fl., No. 108, Jhouzih St.
Neihu District, Taipei
114 Taiwan R.O.C.
Tel: +886-2-8751-1888
Fax: +886-2-8751-1166

Abnova GmbH
Boxbergring 107
69126 Heidelberg
Germany
Tel: +49 6221 3632226
Fax: +49 6221 825878

Customer Service: +886-2-8751-1888
Fax Number: +886-2-8751-1166
Web Site: http://www.abnova.com.tw
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Mouse Anti-Amodiaquine Monoclonal Antibody, Unconjugated, Clone 6D10 from AntibodyShop A/S
2. Mouse Anti-Protein S Monoclonal Antibody, Unconjugated, Clone HYB 232-02 from Abcam
3. Mouse Anti-Mouse Glutathione S-transferase M1 (GSTM1) Monoclonal Antibody, Unconjugated from Lifespan Biosciences
4. Mouse Anti-Human S-100 alpha/beta chain Monoclonal Antibody, Unconjugated, Clone 8B10 from Santa Cruz Biotechnology, Inc.
5. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Testis from OriGene Technologies
6. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Brain (adult) from OriGene Technologies
7. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (12.5 - day) from OriGene Technologies
8. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (19 - day) from OriGene Technologies
9. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Thymus from OriGene Technologies
10. Mouse Anti-Human Complement factor B Monoclonal Antibody, Unconjugated, Clone 9B6 from AntibodyShop A/S
11. Mouse Anti-Human Choriongonadotropin (hCG) Monoclonal Antibody, Unconjugated, Clone 5F10 from AntibodyShop A/S
... Short Stroke Thrust Slide is designed for ... envelopes are limited and substantial side-loading is ... bumpers provide millions of trouble-free cycles even ... composite bushings or recirculating ball bearings , ...
Hamster Serum; U.S. sourced, ideal for those who seek an uncompromising quality. Low Hemoglobin levels; U.S. sourced, ideal for those who seek an uncompromising quality. Low Hemoglobin levels....
Alkaline Phosphatase (E. coli C75), 100 units. Removes 5'-phosphates from DNA. Category: Nucleotides & Enzymes & Biochemicals, Modifying Enzymes, Alkaline Phosphatases....
... System - dCTP with CyScribe GFX ... generation and purification of Cy3- and ... for complete cDNA labeling and purification.Flexible ... for performing labeling reactions with either ...
Biology Products:
(Date:4/3/2017)... WASHINGTON , April 3, 2017 /PRNewswire-USNewswire/ ... single-cell precision engineering platform, detected a statistically ... cell product prior to treatment and objective ... highlight the potential to predict whether cancer ... prior to treatment, as well as to ...
(Date:3/30/2017)... Trends, opportunities and forecast in this market ... (fingerprint, AFIS, iris recognition, facial recognition, hand geometry, vein ... use industry (government and law enforcement, commercial and retail, ... others), and by region ( North America ... Pacific , and the Rest of the World) ...
(Date:3/27/2017)... , March 27, 2017  Catholic Health ... and Management Systems Society (HIMSS) Analytics for achieving ... Adoption Model sm . In addition, CHS previously ... U.S. hospitals using an electronic medical record (EMR). ... its high level of EMR usage in an ...
Breaking Biology News(10 mins):
(Date:10/12/2017)... ... October 12, 2017 , ... The Blavatnik Family Foundation and ... Finalists of the 2017 Blavatnik Regional Awards for Young Scientists. Established in ... by the New York Academy of Sciences to honor the excellence of outstanding ...
(Date:10/12/2017)... ... October 12, 2017 , ... AMRI, a global ... industries to improve patient outcomes and quality of life, will now be offering ... being attributed to new regulatory requirements for all new drug products, including the ...
(Date:10/11/2017)... ... ... wash is a basic first aid supply for any work environment, but most personal eye ... first if a dangerous substance enters both eyes? It’s one less decision, and likely quicker ... eye piece. , “Whether its dirt and debris, or an acid or alkali, getting anything ...
(Date:10/11/2017)... LAGUNA HILLS, Calif. , Oct. 11, 2017 /PRNewswire/ ... London (ICR) and University of ... tool to risk-stratify patients with multiple myeloma (MM), in a ... . The University of Leeds is ... Myeloma UK, and ICR will perform the testing services to ...
Breaking Biology Technology: