Navigation Links
Mouse Anti-TOPORS Monoclonal Antibody, Unconjugated, Clone 4G4 from Abnova Corporation

ProductsMouse Anti-TOPORS Monoclonal Antibody, Unconjugated, Clone 4G4 from Abnova Corporation
Company Abnova Corporation
Item Mouse Anti-TOPORS Monoclonal Antibody, Unconjugated, Clone 4G4
Price 
Description Mouse monoclonal antibody raised against a partial recombinant TOPORS.
Immunogen: TOPORS (NP_005793, 98 a.a. ~ 206 a.a) partial recombinant protein with GST tag.
Accession Number: NM_005802
Protein Sequence: SPDSKCPICLDRFDNVSYLDRCLHKFCFRCVQEWSKNKAECPLCKQPFDSIFHSVRAEDDFKEYVLRPSYNGSFVTPDRRFRYRTTLTRERNASVYSPSGPVNRRTTT*
Info Abnova CorporationAbnova Corporation
Abnova Corporation (HQ)
9th Fl., No. 108, Jhouzih St.
Neihu District, Taipei
114 Taiwan R.O.C.
Tel: +886-2-8751-1888
Fax: +886-2-8751-1166

Abnova GmbH
Boxbergring 107
69126 Heidelberg
Germany
Tel: +49 6221 3632226
Fax: +49 6221 825878

Customer Service: +886-2-8751-1888
Fax Number: +886-2-8751-1166
Web Site: http://www.abnova.com.tw
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Mouse Anti-Amodiaquine Monoclonal Antibody, Unconjugated, Clone 6D10 from AntibodyShop A/S
2. Mouse Anti-Protein S Monoclonal Antibody, Unconjugated, Clone HYB 232-02 from Abcam
3. Mouse Anti-Mouse Glutathione S-transferase M1 (GSTM1) Monoclonal Antibody, Unconjugated from Lifespan Biosciences
4. Mouse Anti-Human S-100 alpha/beta chain Monoclonal Antibody, Unconjugated, Clone 8B10 from Santa Cruz Biotechnology, Inc.
5. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Testis from OriGene Technologies
6. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Brain (adult) from OriGene Technologies
7. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (12.5 - day) from OriGene Technologies
8. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (19 - day) from OriGene Technologies
9. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Thymus from OriGene Technologies
10. Mouse Anti-Human Complement factor B Monoclonal Antibody, Unconjugated, Clone 9B6 from AntibodyShop A/S
11. Mouse Anti-Human Choriongonadotropin (hCG) Monoclonal Antibody, Unconjugated, Clone 5F10 from AntibodyShop A/S
...
Collected from sexually matured, mixed breed, mixed sex guinea pigs....
Antibody specific for phosphorylattion of histone H3 that occurs during mitosis. Rabbit polyclonal serum. Antigen: Synthetic peptides derived from histone H3, phosphorylated at serines 10 or 28...
DTT, 25g...
Biology Products:
(Date:12/10/2014)... RALEIGH, N.C. , Dec. 9, 2014  Valencell, ... announced it is seeing a staggering demand from its ... demand, the Company revealed, is not solely coming from ... industries as well. "A wearable is only ... a result, accuracy is the ultimate driver in long-term ...
(Date:12/10/2014)... December 9, 2014   ... Platform   Jifflenow, ... scheduling solutions for business-to-business (B2B) events, today announced ... in mobile near-field communication (NFC), Bluetooth low energy ... (Logo: http://photos.prnewswire.com/prnh/20140612/691055) , Jifflenow will integrate ...
(Date:12/3/2014)... IRVINE, Calif. , Dec. 2, 2014 /PRNewswire/ ... of globally deployed, innovative test solutions for military, ... the newest version of its successful TS-900 ... the performance and features of high-end systems to ... with outstanding value compared to traditional ATE. ...
Breaking Biology News(10 mins):Wearable Technology Products Demand Highly Accurate Biometric Technology 2Jifflenow And ITN International Bring Cutting-Edge Badge Scanning Technology To B2B Events 2Jifflenow And ITN International Bring Cutting-Edge Badge Scanning Technology To B2B Events 3Marvin Test Solutions Brings New Capabilities to PXI-Based Semiconductor Test with TS-960 2Marvin Test Solutions Brings New Capabilities to PXI-Based Semiconductor Test with TS-960 3
... jaw of a 120 million year old marine reptile suggest that ... The healed bite wounds were probably made by a member of ... behaviour of extinct sea creatures from the time of dinosaurs. The ... Polonica . Found in the remote desert near the town ...
... when cosmetics, shampoos, skin creams, and other personal care ... to plant-derived extracts and other natural ingredients government ... the silicone-based ingredients long used in these products. That,s ... of Chemical & Engineering News (C&EN), ACS, weekly newsmagazine. ...
... providing the inspiration for University of Adelaide computer science ... increase wind farm productivity. Senior Lecturer Dr Frank ... a "selection of the fittest" step-by-step approach called "evolutionary ... account wake effects, the minimum amount of land needed, ...
Cached Biology News:Battle scars found on an ancient sea monster 2Evolutionary lessons for wind farm efficiency 2
(Date:12/19/2014)... December 18, 2014 Ed Bilsky, Ph.D., ... the Center for Excellence in the Neurosciences (CEN), and ... has been selected as a member of the prestigious ... first neuroscientist from Maine to receive this honor. , ... supported entirely by the Dana Foundation. Its mission ...
(Date:12/19/2014)... 2014 With only 2 weeks left ... on Sartorius Biohit products . The product specials include ... Electronic Pipette Trade-in Program, and free pipette tips. , ... around the world. They are ideal for lab technicians ... ,     Full volume range of 0.1 uL ...
(Date:12/17/2014)... 2014 The Activated Carbon Manufacturing ... is why IBISWorld updated its original industry research report. ... from an intensified focus on environmental policy. Over the ... standards for power plants and a range of other ... Industry Analyst Sarah Kahn, “a range of downstream industrial ...
(Date:12/17/2014)... 2014 Once more, EMAAR has ... packaged waste water treatment plant to phase one of ... (KAEC). Two years ago Bioshaft successfully supplied and operated ... two residential towers with an occupancy of 900 residences. ... million gallons per day and was signed on September ...
Breaking Biology Technology:UNE's Ed Bilsky Named Member of Dana Alliance for Brain Initiatives 2UNE's Ed Bilsky Named Member of Dana Alliance for Brain Initiatives 3Major Pipette Distributor Pipette.com Announces Sartorius Year End Specials 2Activated Carbon Manufacturing in the US Industry Market Research Report Has Been Updated from IBISWorld 2Activated Carbon Manufacturing in the US Industry Market Research Report Has Been Updated from IBISWorld 3