Navigation Links
Mouse Anti-TOPORS Monoclonal Antibody, Unconjugated, Clone 4G4 from Abnova Corporation

ProductsMouse Anti-TOPORS Monoclonal Antibody, Unconjugated, Clone 4G4 from Abnova Corporation
Company Abnova Corporation
Item Mouse Anti-TOPORS Monoclonal Antibody, Unconjugated, Clone 4G4
Price 
Description Mouse monoclonal antibody raised against a partial recombinant TOPORS.
Immunogen: TOPORS (NP_005793, 98 a.a. ~ 206 a.a) partial recombinant protein with GST tag.
Accession Number: NM_005802
Protein Sequence: SPDSKCPICLDRFDNVSYLDRCLHKFCFRCVQEWSKNKAECPLCKQPFDSIFHSVRAEDDFKEYVLRPSYNGSFVTPDRRFRYRTTLTRERNASVYSPSGPVNRRTTT*
Info Abnova CorporationAbnova Corporation
Abnova Corporation (HQ)
9th Fl., No. 108, Jhouzih St.
Neihu District, Taipei
114 Taiwan R.O.C.
Tel: +886-2-8751-1888
Fax: +886-2-8751-1166

Abnova GmbH
Boxbergring 107
69126 Heidelberg
Germany
Tel: +49 6221 3632226
Fax: +49 6221 825878

Customer Service: +886-2-8751-1888
Fax Number: +886-2-8751-1166
Web Site: http://www.abnova.com.tw
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Mouse Anti-Amodiaquine Monoclonal Antibody, Unconjugated, Clone 6D10 from AntibodyShop A/S
2. Mouse Anti-Protein S Monoclonal Antibody, Unconjugated, Clone HYB 232-02 from Abcam
3. Mouse Anti-Mouse Glutathione S-transferase M1 (GSTM1) Monoclonal Antibody, Unconjugated from Lifespan Biosciences
4. Mouse Anti-Human S-100 alpha/beta chain Monoclonal Antibody, Unconjugated, Clone 8B10 from Santa Cruz Biotechnology, Inc.
5. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Testis from OriGene Technologies
6. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Brain (adult) from OriGene Technologies
7. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (12.5 - day) from OriGene Technologies
8. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (19 - day) from OriGene Technologies
9. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Thymus from OriGene Technologies
10. Mouse Anti-Human Complement factor B Monoclonal Antibody, Unconjugated, Clone 9B6 from AntibodyShop A/S
11. Mouse Anti-Human Choriongonadotropin (hCG) Monoclonal Antibody, Unconjugated, Clone 5F10 from AntibodyShop A/S
... These are just some the things youll be ... Protein-Protein Interactions, edited by Erica Golemis, One look ... edited compilation of topics in protein interaction will ... that must be a part of your personal ...
... acid gel stain has bright fluorescence when bound ... it ideal for detecting dsDNA in gels using ... Green I nucleic acid stain has also ... assays and bandshift assays. A 500 µL unit ...
... 2) Dot plot, Contour plot, Density Plot, ... 4) Cell Cycle 5) Analysis Platform ... generation of graphs and statistics 8) Advanced ... to perform complex batch analyses 10) Exporting ...
Synonym: modified Grace's Insect medium...
Biology Products:
(Date:12/16/2016)... Dec 16, 2016 Research and Markets has ... - Global Forecast to 2021" report to their offering. ... The biometric vehicle ... at a CAGR of 14.06% from 2016 to 2021. The market ... projected to reach 854.8 Million by 2021. The growth of the ...
(Date:12/15/2016)... FREMONT, Calif. , Dec. 15, 2016   ... a publicly held genomics technology company, announced today that ... the Listing Qualifications Department of The Nasdaq Stock Market ... the closing bid price of WaferGen,s common stock had ... days.  Accordingly, WaferGen has regained compliance with Listing Rule ...
(Date:12/15/2016)... , Dec. 15, 2016  There is much ... doors or starting the engine. Continental will demonstrate the ... Las Vegas . Through the combination of ... and Entry) and biometric elements, the international technology company ... vehicle personalization and authentication. "The integration of ...
Breaking Biology News(10 mins):
(Date:1/18/2017)... ... January 18, 2017 , ... Executive search ... in its continued commitment to the advancement of the clinical trials segment. Hosted ... related to clinical trial planning and management. , As executive talent specialists ...
(Date:1/18/2017)... ... January 18, 2017 , ... Announced in ... Innovation Institutes (MII). U.S. Secretary of Commerce Penny Pritzker has announced the award ... Department of Defense has announced the award of a new Advanced Regenerative Manufacturing ...
(Date:1/18/2017)... (PRWEB) , ... January 18, 2017 , ... ... again at the CHI SCOPE Summit for Clinical Ops Executives (Hyatt Regency Miami, ... panel discussions to examine vital clinical research issues such as trial performance metrics, ...
(Date:1/18/2017)... ... January 18, 2017 , ... Thirty-six startup companies in University City and ... Department of Community and Economic Development in 2016 as part of the Keystone Innovation ... City Keystone Innovation Zone and represent the highest number of awards to the largest ...
Breaking Biology Technology: