Navigation Links
Mouse Anti-TOPORS Monoclonal Antibody, Unconjugated, Clone 4G4 from Abnova Corporation

ProductsMouse Anti-TOPORS Monoclonal Antibody, Unconjugated, Clone 4G4 from Abnova Corporation
Company Abnova Corporation
Item Mouse Anti-TOPORS Monoclonal Antibody, Unconjugated, Clone 4G4
Price 
Description Mouse monoclonal antibody raised against a partial recombinant TOPORS.
Immunogen: TOPORS (NP_005793, 98 a.a. ~ 206 a.a) partial recombinant protein with GST tag.
Accession Number: NM_005802
Protein Sequence: SPDSKCPICLDRFDNVSYLDRCLHKFCFRCVQEWSKNKAECPLCKQPFDSIFHSVRAEDDFKEYVLRPSYNGSFVTPDRRFRYRTTLTRERNASVYSPSGPVNRRTTT*
Info Abnova CorporationAbnova Corporation
Abnova Corporation (HQ)
9th Fl., No. 108, Jhouzih St.
Neihu District, Taipei
114 Taiwan R.O.C.
Tel: +886-2-8751-1888
Fax: +886-2-8751-1166

Abnova GmbH
Boxbergring 107
69126 Heidelberg
Germany
Tel: +49 6221 3632226
Fax: +49 6221 825878

Customer Service: +886-2-8751-1888
Fax Number: +886-2-8751-1166
Web Site: http://www.abnova.com.tw
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Mouse Anti-Amodiaquine Monoclonal Antibody, Unconjugated, Clone 6D10 from AntibodyShop A/S
2. Mouse Anti-Protein S Monoclonal Antibody, Unconjugated, Clone HYB 232-02 from Abcam
3. Mouse Anti-Mouse Glutathione S-transferase M1 (GSTM1) Monoclonal Antibody, Unconjugated from Lifespan Biosciences
4. Mouse Anti-Human S-100 alpha/beta chain Monoclonal Antibody, Unconjugated, Clone 8B10 from Santa Cruz Biotechnology, Inc.
5. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Testis from OriGene Technologies
6. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Brain (adult) from OriGene Technologies
7. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (12.5 - day) from OriGene Technologies
8. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (19 - day) from OriGene Technologies
9. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Thymus from OriGene Technologies
10. Mouse Anti-Human Complement factor B Monoclonal Antibody, Unconjugated, Clone 9B6 from AntibodyShop A/S
11. Mouse Anti-Human Choriongonadotropin (hCG) Monoclonal Antibody, Unconjugated, Clone 5F10 from AntibodyShop A/S
MMP-2 / MMP-9 Inhibitor IV is a potent, selective, slow binding and mechanism based inhibitor of human gelatinases. • Molecular weight: 306.4 • Molecular Formula: C(15)H(14)O(3)S(2). &bul...
... is a glycoprotein. distributed in colon ... in breast, lung and salivary gland tissues. ... with MUC1 and MUC2. Epitope: ... Immunogen: MUC3 tandem repeat peptide ...
... Nonreversible lids with condensation ... Individual alphanumerical codes for ... for ease in stacking,• ... attachment,• Sterilized by gamma ...
Rabbit polyclonal to GABA A Receptor gamma 2 ( Abpromise for all tested applications). entrezGeneID: 2566 SwissProtID: P18507...
Biology Products:
(Date:3/7/2017)... -- Brandwatch , the leading social intelligence company, today announces ... to uncover insights to support its reporting, help direct future campaigns, ... leading youth charity will be using Brandwatch Analytics social listening and ... understanding of the topics and issues that are a priority for ... "Until ...
(Date:3/2/2017)... March 2, 2017 Who risk to be ... Download the full report: https://www.reportbuyer.com/product/4313699/ WILL ... SENSOR FIELD? Fingerprint sensors using capacitive technology represent ... sensor vendor Idex forecasts an increase of 360% of ... and of the fingerprint sensor market between 2014 and ...
(Date:2/28/2017)...  EyeLock LLC, ein marktführendes Unternehmen im Bereich ... Lösung zur Iris-Erkennung auf der neuesten Mobilplattform ... dem Mobile World Congress 2017 (27. Februar ... 3, Stand 3E10, vorstellen. Der ... – eine Kombination aus Hardware, Software und ...
Breaking Biology News(10 mins):
(Date:3/23/2017)... March 23, 2017  BioPharmX Corporation (NYSE MKT: ... the dermatology market, today reported financial results for ... and will provide an update on the company,s ... "We are pleased to report that ... BioPharmX," said President Anja Krammer. "We achieved key ...
(Date:3/23/2017)... , March 23, 2017 NetworkNewsWire Editorial ... ... putting significant strain on health care systems, in terms of ... rises, so too does the development of innovative and efficient ... effects. Among the many types of cancer treatments, a growing ...
(Date:3/23/2017)... NEW YORK , March 23, 2017 ... closer look at four equities in the Biotech industry: ... EYEG), Synthetic Biologics Inc. (NYSE MKT: SYN), and Regulus ... March 21 st , 2017, Credit Suisse upgraded its rating ... stocks by downloading their free report at: ...
(Date:3/22/2017)... ... March 22, 2017 , ... Researchers face a fundamental ... samples to full-size tissues, bones, even whole organs to implant in people to ... blood deep into the developing tissue. , Current bioengineering techniques, including 3-D ...
Breaking Biology Technology: