Navigation Links
Mouse Anti-TOPORS Monoclonal Antibody, Unconjugated, Clone 4G4 from Abnova Corporation

ProductsMouse Anti-TOPORS Monoclonal Antibody, Unconjugated, Clone 4G4 from Abnova Corporation
Company Abnova Corporation
Item Mouse Anti-TOPORS Monoclonal Antibody, Unconjugated, Clone 4G4
Price 
Description Mouse monoclonal antibody raised against a partial recombinant TOPORS.
Immunogen: TOPORS (NP_005793, 98 a.a. ~ 206 a.a) partial recombinant protein with GST tag.
Accession Number: NM_005802
Protein Sequence: SPDSKCPICLDRFDNVSYLDRCLHKFCFRCVQEWSKNKAECPLCKQPFDSIFHSVRAEDDFKEYVLRPSYNGSFVTPDRRFRYRTTLTRERNASVYSPSGPVNRRTTT*
Info Abnova CorporationAbnova Corporation
Abnova Corporation (HQ)
9th Fl., No. 108, Jhouzih St.
Neihu District, Taipei
114 Taiwan R.O.C.
Tel: +886-2-8751-1888
Fax: +886-2-8751-1166

Abnova GmbH
Boxbergring 107
69126 Heidelberg
Germany
Tel: +49 6221 3632226
Fax: +49 6221 825878

Customer Service: +886-2-8751-1888
Fax Number: +886-2-8751-1166
Web Site: http://www.abnova.com.tw
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Mouse Anti-Amodiaquine Monoclonal Antibody, Unconjugated, Clone 6D10 from AntibodyShop A/S
2. Mouse Anti-Protein S Monoclonal Antibody, Unconjugated, Clone HYB 232-02 from Abcam
3. Mouse Anti-Mouse Glutathione S-transferase M1 (GSTM1) Monoclonal Antibody, Unconjugated from Lifespan Biosciences
4. Mouse Anti-Human S-100 alpha/beta chain Monoclonal Antibody, Unconjugated, Clone 8B10 from Santa Cruz Biotechnology, Inc.
5. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Testis from OriGene Technologies
6. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Brain (adult) from OriGene Technologies
7. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (12.5 - day) from OriGene Technologies
8. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (19 - day) from OriGene Technologies
9. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Thymus from OriGene Technologies
10. Mouse Anti-Human Complement factor B Monoclonal Antibody, Unconjugated, Clone 9B6 from AntibodyShop A/S
11. Mouse Anti-Human Choriongonadotropin (hCG) Monoclonal Antibody, Unconjugated, Clone 5F10 from AntibodyShop A/S
... range of next-generation features into a small-footprint ... for flexible laboratory solutions. It puts every ... dilution, dispensing, and integrations into a ... flexible as it is efficient and economical. ...
... trays are disposable trays that ... that have been blotted onto ... eight 10.5 cm x 5 ... cut from blotted membrane and ...
... System provides high-throughput, quantitative gene expression analysis ... patented priming strategy overcomes the biases that ... a few genes at a time. ... and more samples per run, removing bottlenecks ...
... is a simple high performance method for ... detergents without significant dilution of protein solution. ... the Detergent-OUT Spin column and collect detergent ... suitable for removing detergent from a maximum ...
Biology Products:
(Date:4/6/2017)... Forecasts by Product Type (EAC), Biometrics, Card-Based ... & Logistics, Government & Public Sector, Utilities / Energy ... Nuclear Power), Industrial, Retail, Business Organisation (BFSI), Hospitality & ... for a definitive report on the $27.9bn Access Control ... ...
(Date:4/3/2017)... April 3, 2017  Data captured by ... platform, detected a statistically significant association between ... to treatment and objective response of cancer ... to predict whether cancer patients will respond ... as well as to improve both pre-infusion potency ...
(Date:3/28/2017)... , March 28, 2017 The ... Hardware (Camera, Monitors, Servers, Storage Devices), Software (Video Analytics, ... Region - Global Forecast to 2022", published by MarketsandMarkets, ... 2016 and is projected to reach USD 75.64 Billion ... and 2022. The base year considered for the study ...
Breaking Biology News(10 mins):
(Date:5/23/2017)... ... May 22, 2017 , ... NetDimensions has been ranked ... Research Globe™ for Corporate Learning, 2017. , Aragon Research defines Leaders as organizations ... effectively perform against those strategies. NetDimensions’ ranking as a Leader due to its ...
(Date:5/23/2017)... CA (PRWEB) , ... May 23, 2017 , ... Bacterial ... of polymeric molecules, can cause diverse pathologies ranging from food poisoning and catheter infections ... of biofilms is in the tens of billions of dollars per year, there is ...
(Date:5/22/2017)... Pittsburgh, PA (PRWEB) , ... May 22, 2017 ... ... Inc. announced today that it is exhibiting in booth B2 at the Association ... in Pittsburgh, May 22-25. , In addition to demonstrating its Cancer Diagnostic ...
(Date:5/18/2017)... ... May 18, 2017 , ... Dr. ... 2017 at the Prince Of Wales Private Hospital. The procedure was performed on ... The patient failed conservative treatments prior to undergoing surgery. , The AxioMed viscoelastic ...
Breaking Biology Technology: