Mouse Anti-TOPORS Monoclonal Antibody, Unconjugated, Clone 4G4 from Abnova Corporation

Products	Mouse Anti-TOPORS Monoclonal Antibody, Unconjugated, Clone 4G4 from Abnova Corporation
Company	Abnova Corporation
Item	Mouse Anti-TOPORS Monoclonal Antibody, Unconjugated, Clone 4G4
Price
Description	Mouse monoclonal antibody raised against a partial recombinant TOPORS. Immunogen: TOPORS (NP_005793, 98 a.a. ~ 206 a.a) partial recombinant protein with GST tag. Accession Number: NM_005802 Protein Sequence: SPDSKCPICLDRFDNVSYLDRCLHKFCFRCVQEWSKNKAECPLCKQPFDSIFHSVRAEDDFKEYVLRPSYNGSFVTPDRRFRYRTTLTRERNASVYSPSGPVNRRTTT*
Info	Abnova Corporation Abnova Corporation (HQ) 9th Fl., No. 108, Jhouzih St. Neihu District, Taipei 114 Taiwan R.O.C. Tel: +886-2-8751-1888 Fax: +886-2-8751-1166 Abnova GmbH Boxbergring 107 69126 Heidelberg Germany Tel: +49 6221 3632226 Fax: +49 6221 825878 Customer Service: +886-2-8751-1888 Fax Number: +886-2-8751-1166 Web Site: http://www.abnova.com.tw

NOTE: Price information is approximate list price and actual prices may vary.

Rabbit polyclonal to ErbB 2 (phospho Y1248) ( Abpromise for all tested applications). entrezGeneID: 2064 SwissProtID: P04626...

...

... Blot Strong Antibody Stripping Solution is effective ... that have been developed with chemiluminescence or ... not recommended for stripping colorimetric substrates (TMB, ... possible to effectively remove substrates that precipitate ...

... supplied as a 5x solution. Designed ... membrane-bound proteins without destroying antigenic binding ... radioisotopic signals from blots. Not recommended ... as a 5X solution sufficient to ...

Biology Products:

Rabbit Anti-ErbB2, phospho (Tyr1248) Polyclonal Antibody, Unconjugated from Abcam Protease Inhibitor Cocktail Set I from Calbiochem ReBlot Plus Strong Antibody Stripping Solution from CHEMICON Western-Re-Probe Reagent from Calbiochem

(Date:5/20/2013)... effect of physical education (PE) on child weight, but ... the amount of time that elementary schoolchildren spent in ... study represents some of the first evidence of a ... forthcoming in the Journal of Health Economics . ... be viewed at: http://www.sciencedirect.com/science/article/pii/S0167629613000556 , The research ...

(Date:5/20/2013)... National Science Foundation (NSF) planning grant will help establish ... joint program of the University of Illinois at Urbana-Champaign ... "CARD will be devoted to research in drying moist, ... forestry and paper products; chemical products; textiles; and biopharmaceuticals," ... food science and human nutrition and the Illinois site ...

(Date:5/20/2013)... articles posted online ahead of print 9 ... of geoscience subdisciplines, including minerals exploration, archaeology, planetary ... include Siberia; the Sumatran subduction margin; the Monte ... and the Southeastern U.S. Atlantic Margin. Brief highlights ... tectonics;, 2. The clear fingerprint of ice ages ...

[0] Gym class reduces probability of obesity, study finds for first time [0] NSF approves planning grant for Center for Advanced Research in Drying [0] New in GEOLOGY: Gems, Darwin, Mars, Hemp, Snowball Earth, a Siberian Impact Crater, and More

... deliver payloads of cancer-fighting drugs to tumors in the ... But scientists are still at a relatively early stage ... Although developing nanoparticles that work as "magic bullets" ... is still the goal, the reality is that most ...

... MARC (Minority Access to Research Careers) Program has announced ... of America (GSA) Mouse Genetics conference in Washington, DC ... to promote the entry of underrepresented minority students, postdoctorates ... community and to encourage the participation of young scientists ...

... Royal Swedish Academy of Sciences, Margareta is the editor of ... changes we see are dramatic. And they are not coincidental. ... compared with a longer term perspective", she says. The ... is warming up fastest today. Measurements of air temperature show ...

Cached Biology News:Hitting target in cancer fight now easier with new nanoparticle platform, UCLA scientists say 2 A new research report shows effects of climate change in the Arctic are more extensive than expected 2 A new research report shows effects of climate change in the Arctic are more extensive than expected 3

Hitting target in cancer fight now easier with new nanoparticle platform, UCLA scientists say MARC travel awards announced for GSA Mouse Genetics Conference A new research report shows effects of climate change in the Arctic are more extensive than expected

(Date:5/21/2013)... (PRWEB) May 21, 2013 Vital ... the University of California, San Diego for a joint ... bearing Gravitic™ MRI (Magnetic Resonance Imaging) with that of ... for its continued pursuit of improved healthcare by combining ... MRI is an extremely valuable tool for evaluating pathological ...

(Date:5/21/2013)... 21, 2013 PathoGenetix, Inc., a commercial-stage ... typing, announced today that it has successfully identified and ... strains obtained from the Centers for Disease Control and ... technology. The findings are detailed in a poster ... Society for Microbiology in Denver on Monday. , The ...

(Date:5/20/2013)... MELBOURNE, Australia , May 20, 2013 ... of Agriculture,s (USDA) Agricultural Research Service (ARS) in ... market opportunity , Trials to begin ... Australian drug delivery technology company Phosphagenics Limited ... U.S. Department of Agriculture,s (USDA) Agricultural Research Service (ARS) ...

(Date:5/20/2013)... Ga. , May 20, 2013 MiMedx Group, ... manufacturer and marketer of patent protected regenerative biomaterials and ... it has secured a revolving line of credit with ... which is secured by the Company,s accounts receivable and ... through May 1, 2014. The facility will be used ...

Breaking Biology Technology:Vital Imaging Makes Greater Commitment into MRI Research 2 Vital Imaging Makes Greater Commitment into MRI Research 3 New Genotyping System Identifies Pathogenic E. coli Outbreak Strains 2 New Genotyping System Identifies Pathogenic E. coli Outbreak Strains 3 Phosphagenics Signs Research Agreement with the Agricultural Research Service 2

[0] Vital Imaging Makes Greater Commitment into MRI Research [0] New Genotyping System Identifies Pathogenic E. coli Outbreak Strains [0] Phosphagenics Signs Research Agreement with the Agricultural Research Service [0] MiMedx Secures a $3.0 Million Revolving Line of Credit with Bank of America