Navigation Links
Mouse Anti-SLC22A3 Polyclonal Antibody, Unconjugated from Abnova Corporation

ProductsMouse Anti-SLC22A3 Polyclonal Antibody, Unconjugated from Abnova Corporation
Company Abnova Corporation
Item Mouse Anti-SLC22A3 Polyclonal Antibody, Unconjugated
Price 
Description Mouse polyclonal antibody raised against a partial recombinant SLC22A3.
Immunogen: SLC22A3 (NP_068812, 90 a.a. ~ 156 a.a) partial recombinant protein with GST tag.
Accession Number: NM_021977
Protein Sequence: CQRYLLEAANDSASATSALSCADPLAAFPNRSAPLVPCRGGWRYAQAHSTIVSEFDLVCVNAWMLD*
Info Abnova CorporationAbnova Corporation
Abnova Corporation (HQ)
9th Fl., No. 108, Jhouzih St.
Neihu District, Taipei
114 Taiwan R.O.C.
Tel: +886-2-8751-1888
Fax: +886-2-8751-1166

Abnova GmbH
Boxbergring 107
69126 Heidelberg
Germany
Tel: +49 6221 3632226
Fax: +49 6221 825878

Customer Service: +886-2-8751-1888
Fax Number: +886-2-8751-1166
Web Site: http://www.abnova.com.tw
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Mouse Anti-Amodiaquine Monoclonal Antibody, Unconjugated, Clone 6D10 from AntibodyShop A/S
2. Mouse Anti-Protein S Monoclonal Antibody, Unconjugated, Clone HYB 232-02 from Abcam
3. Mouse Anti-Mouse Glutathione S-transferase M1 (GSTM1) Monoclonal Antibody, Unconjugated from Lifespan Biosciences
4. Mouse Anti-Human S-100 alpha/beta chain Monoclonal Antibody, Unconjugated, Clone 8B10 from Santa Cruz Biotechnology, Inc.
5. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Testis from OriGene Technologies
6. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Brain (adult) from OriGene Technologies
7. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (12.5 - day) from OriGene Technologies
8. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (19 - day) from OriGene Technologies
9. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Thymus from OriGene Technologies
10. Mouse Anti-Human Complement factor B Monoclonal Antibody, Unconjugated, Clone 9B6 from AntibodyShop A/S
11. Mouse Anti-Human Choriongonadotropin (hCG) Monoclonal Antibody, Unconjugated, Clone 5F10 from AntibodyShop A/S
... Cell Identification Kit. ALDEFLUORs ... substrate for the enzyme ... is highly expressed in ... making ALDH an extremely ...
... The MetaVue Imaging System is the cost-effective ... With commands tailored to common research imaging ... morphometric analysis and simple image analysis. ... control library means that MetaVue has the ...
Sterile, Cell culture tested...
... have been many modifications to the original formulas ... solutions still play an important role in tissue,culture. ... pH and osmotic balance in the medium and ... inorganic ions, is as valuable today as when ...
Biology Products:
(Date:9/16/2014)... vital functions in an organism. For example, they ... and control immune system responses. Researchers established some ... of each other, but instead form complex networks. ... find many similarities with online social networks," says ... Systems Biology. "Some proteins are good networkers that ...
(Date:9/16/2014)... season of bounty. Fungi of dizzying variety erupt from ... search of elusive but delectable wild mushrooms. Part of ... hunt, and their mysterious not-quite-meat, not-quite-vegetable qualities that belie ... you are eating known to science? , The Fungi ... some estimates range up to 10 million species, only ...
(Date:9/15/2014)... mechanical solution to avoid chromosome sorting errors, researchers ... Express. , This natural safeguard prevents ... infertility, miscarriage, or congenital conditions. , "Mistakes ... what exactly goes wrong is often not understood," ... for Cell Biology at the University of Edinburgh ...
Breaking Biology News(10 mins):Good networkers make prime targets 2What's for dinner? Rapidly identifying undescribed species in a commercial fungi packet 2What's for dinner? Rapidly identifying undescribed species in a commercial fungi packet 3Cells simply avoid chromosome confusion 2Cells simply avoid chromosome confusion 3
... VCU Life Sciences Survey is the first poll to ... skin cells can be used to create stem cells ... of this development, more than six in 10, or ... cell research is still needed, 22 percent say this ...
... Expert Supports Open, Innovative ... ... further advanced its capabilities and offerings in biometrics,solutions through a cooperation ... agreement will enable closer,cooperation between the two companies in the rapidly ...
... at The University of Texas Medical School at Houston ... and spina bifida. The decade-long study looked at more ... with that birth defect. UT Medical School researchers ... in glucose metabolism to look for a link between ...
Cached Biology News:Widespread support for nonembryonic stem cell research, VCU Life Sciences Survey shows 2Lockheed Martin Advances Biometrics Portfolio Through Cooperation Agreement With Cognitec 2UT-Houston's Northrup and colleagues uncover genetic link to spina bifida 2
(Date:9/15/2014)... carbon nanotubes is neat, but Rice University scientists are making ... new fibers created at Rice line up like a fistful ... Mart and his colleagues. , The tricky bit, according to ... journal ACS Nano , is keeping the densely packed ... Left to their own devices, carbon nanotubes form clumps that ...
(Date:9/15/2014)... 15, 2014 Bioptigen announced ... OCT system for the optical device metrology and pre-clinical ... S4410 SDOCT for Contact Lens Metrology is designed ... high complexity contact lens, IOL structures, and donor tissues. ... complete contact lens immersed in a hydration bath (saline), ...
(Date:9/15/2014)... 15, 2014  iVinci Health LLC, the company behind ... Management system, branded as VisitPay®, has successfully closed $5 ... launch of a new extension to VisitPay® – an ... and convenient way for patients to manage their medical ... them and their families. The new round ...
(Date:9/15/2014)... The chemistry, taste, and health effects of tea ... published by the nonprofit American Botanical Council (ABC). Recent research ... its effects on the phytochemical compounds in tea ( Camellia ... Dr. Ahmed in the Yunnan province ... for the future of medicinal botanicals. Dr. Ahmed,s report ...
Breaking Biology Technology:Rice rolls 'neat' nanotube fibers 2Rice rolls 'neat' nanotube fibers 3Bioptigen Introduces Deep Imaging OCT System for Contact Lens Metrology 2iVinci Health Raises $5M to Fuel National Expansion, Announces Launch of Personal Finance Portal for Healthcare 2iVinci Health Raises $5M to Fuel National Expansion, Announces Launch of Personal Finance Portal for Healthcare 3Tea Taste and Quality Affected by Climate Change 2Tea Taste and Quality Affected by Climate Change 3Tea Taste and Quality Affected by Climate Change 4