Navigation Links
Mouse Anti-SLC22A3 Polyclonal Antibody, Unconjugated from Abnova Corporation

ProductsMouse Anti-SLC22A3 Polyclonal Antibody, Unconjugated from Abnova Corporation
Company Abnova Corporation
Item Mouse Anti-SLC22A3 Polyclonal Antibody, Unconjugated
Price 
Description Mouse polyclonal antibody raised against a partial recombinant SLC22A3.
Immunogen: SLC22A3 (NP_068812, 90 a.a. ~ 156 a.a) partial recombinant protein with GST tag.
Accession Number: NM_021977
Protein Sequence: CQRYLLEAANDSASATSALSCADPLAAFPNRSAPLVPCRGGWRYAQAHSTIVSEFDLVCVNAWMLD*
Info Abnova CorporationAbnova Corporation
Abnova Corporation (HQ)
9th Fl., No. 108, Jhouzih St.
Neihu District, Taipei
114 Taiwan R.O.C.
Tel: +886-2-8751-1888
Fax: +886-2-8751-1166

Abnova GmbH
Boxbergring 107
69126 Heidelberg
Germany
Tel: +49 6221 3632226
Fax: +49 6221 825878

Customer Service: +886-2-8751-1888
Fax Number: +886-2-8751-1166
Web Site: http://www.abnova.com.tw
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Mouse Anti-Amodiaquine Monoclonal Antibody, Unconjugated, Clone 6D10 from AntibodyShop A/S
2. Mouse Anti-Protein S Monoclonal Antibody, Unconjugated, Clone HYB 232-02 from Abcam
3. Mouse Anti-Mouse Glutathione S-transferase M1 (GSTM1) Monoclonal Antibody, Unconjugated from Lifespan Biosciences
4. Mouse Anti-Human S-100 alpha/beta chain Monoclonal Antibody, Unconjugated, Clone 8B10 from Santa Cruz Biotechnology, Inc.
5. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Testis from OriGene Technologies
6. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Brain (adult) from OriGene Technologies
7. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (12.5 - day) from OriGene Technologies
8. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (19 - day) from OriGene Technologies
9. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Thymus from OriGene Technologies
10. Mouse Anti-Human Complement factor B Monoclonal Antibody, Unconjugated, Clone 9B6 from AntibodyShop A/S
11. Mouse Anti-Human Choriongonadotropin (hCG) Monoclonal Antibody, Unconjugated, Clone 5F10 from AntibodyShop A/S
... Disposable. Virgin, optically clear polystyrene ... and alphanumeric coordinates for cell counting. ... number is a new product number, ... number. If showing no availability yet, ...
... This CLS number is ... to easily match Cornings product ... yet, please order under the ... contact customer service for assistance. ...
ABgene® supplies a 94kDa ultra-pure recombinant thermostable DNA polymerase obtained by high level expression of the Taq DNA polymerase gene in E. coli....
From formula-fed bovine calves Sterile, Cell culture tested...
Biology Products:
(Date:2/13/2017)... , Feb. 13, 2017 Former 9/11 Commission ... Judiciary Committee, Janice Kephart of Identity Strategy ... Donald Trump,s "Executive Order: Protecting the Nation ... 27, 2017):  "As President Trump,s ,Travel Ban, ... has now essentially banned the travel ban, it is ...
(Date:2/9/2017)... LONDON , Feb. 9, 2017 The ... in-depth analysis of the biomass boiler market globally in ... sales of biomass boilers. The market for biomass boilers ... product type, end-user, application, and country/region. The market based ... agriculture & forest residues, biogas & energy crops, urban ...
(Date:2/8/2017)... AWRE ), a leading supplier of biometrics software ... year ended December 31, 2016. Revenue for ... $6.9 million in the same quarter last year. Operating income ... to $2.6 million in the fourth quarter of 2015. Net ... or $0.02 per diluted share, which compares to $1.8 million, ...
Breaking Biology News(10 mins):
(Date:3/23/2017)... ... ... proud to announce it has become the premiere team-building cooking event company in San Diego. ... such as Illumina, HP and Qualcomm, and is ranked #1 in its category on Trip ... its new team building format, a way for teams to not only interact with one ...
(Date:3/23/2017)... MILFORD, Mass. , March 23, 2017 ... leading partner to global in vitro diagnostics ... launch of the industry,s first multiplexed ... inherited disease testing by next-generation sequencing ... materials were developed with input from industry ...
(Date:3/23/2017)... ... March 23, 2017 , ... ... by the Connecticut Technology Council (CTC) as a 2017 Women of Innovation® finalist. ... Women of Innovation Awards Dinner. , The dinner recognizes women accomplished in science, ...
(Date:3/23/2017)... ALBANY, New York , March 23, 2017 ... animal blood plasma products and derivatives market is fragmented due to the ... large players, such as Proliant, Thermo Fisher , and Sigma-Aldrich, ... clear leader, these three companies, collectively, held more than 76% of ... ...
Breaking Biology Technology: