Navigation Links
Mouse Anti-SLC22A3 Polyclonal Antibody, Unconjugated from Abnova Corporation

ProductsMouse Anti-SLC22A3 Polyclonal Antibody, Unconjugated from Abnova Corporation
Company Abnova Corporation
Item Mouse Anti-SLC22A3 Polyclonal Antibody, Unconjugated
Price 
Description Mouse polyclonal antibody raised against a partial recombinant SLC22A3.
Immunogen: SLC22A3 (NP_068812, 90 a.a. ~ 156 a.a) partial recombinant protein with GST tag.
Accession Number: NM_021977
Protein Sequence: CQRYLLEAANDSASATSALSCADPLAAFPNRSAPLVPCRGGWRYAQAHSTIVSEFDLVCVNAWMLD*
Info Abnova CorporationAbnova Corporation
Abnova Corporation (HQ)
9th Fl., No. 108, Jhouzih St.
Neihu District, Taipei
114 Taiwan R.O.C.
Tel: +886-2-8751-1888
Fax: +886-2-8751-1166

Abnova GmbH
Boxbergring 107
69126 Heidelberg
Germany
Tel: +49 6221 3632226
Fax: +49 6221 825878

Customer Service: +886-2-8751-1888
Fax Number: +886-2-8751-1166
Web Site: http://www.abnova.com.tw
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Mouse Anti-Amodiaquine Monoclonal Antibody, Unconjugated, Clone 6D10 from AntibodyShop A/S
2. Mouse Anti-Protein S Monoclonal Antibody, Unconjugated, Clone HYB 232-02 from Abcam
3. Mouse Anti-Mouse Glutathione S-transferase M1 (GSTM1) Monoclonal Antibody, Unconjugated from Lifespan Biosciences
4. Mouse Anti-Human S-100 alpha/beta chain Monoclonal Antibody, Unconjugated, Clone 8B10 from Santa Cruz Biotechnology, Inc.
5. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Testis from OriGene Technologies
6. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Brain (adult) from OriGene Technologies
7. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (12.5 - day) from OriGene Technologies
8. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (19 - day) from OriGene Technologies
9. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Thymus from OriGene Technologies
10. Mouse Anti-Human Complement factor B Monoclonal Antibody, Unconjugated, Clone 9B6 from AntibodyShop A/S
11. Mouse Anti-Human Choriongonadotropin (hCG) Monoclonal Antibody, Unconjugated, Clone 5F10 from AntibodyShop A/S
Umbilical cord blood CD4+ T cells, For immunohistochemistry (IHC) Cell Chip with Human Umbilical Cord Blood MNCs and T Cells...
... an anodized aluminum, solvent-resistant block specially designed ... efficient thermal transfer to samples within the ... HT96 Isothermal Block replaces Cat. No. 71031-3, ... for compatibility with robotic applications. The new ...
...
...
Biology Products:
(Date:3/28/2017)... , March 28, 2017 The ... Hardware (Camera, Monitors, Servers, Storage Devices), Software (Video Analytics, ... Region - Global Forecast to 2022", published by MarketsandMarkets, ... 2016 and is projected to reach USD 75.64 Billion ... and 2022. The base year considered for the study ...
(Date:3/24/2017)... , March 24, 2017 The Controller General ... Controller Mr. Abdulla Algeen have received the prestigious international IAIR ... Continue Reading ... ... picture) and Deputy Controller Abdulla Algeen (small picture on the right) have ...
(Date:3/23/2017)... -- The report "Gesture Recognition and Touchless Sensing Market by Technology ... Forecast to 2022", published by MarketsandMarkets, the market is expected to be worth ... and 2022. Continue Reading ... ... ...
Breaking Biology News(10 mins):
(Date:10/12/2017)... ... October 12, 2017 , ... ... genomics analysis platform specifically designed for life science researchers to analyze and ... researcher Rosalind Franklin, who made a major contribution to the discovery of ...
(Date:10/11/2017)... LINDA, CA (PRWEB) , ... October 11, 2017 ... ... to upregulate any gene in its endogenous context, enabling overexpression experiments and avoiding ... (CRISPRa) system with small RNA guides is transformative for performing systematic gain-of-function studies. ...
(Date:10/11/2017)... (PRWEB) , ... October 11, 2017 , ... ComplianceOnline’s Medical ... place on 7th and 8th June 2018 in San Francisco, CA. The Summit brings ... well as several distinguished CEOs, board directors and government officials from around the world ...
(Date:10/11/2017)... 2017  VMS BioMarketing, a leading provider of patient support ... Nurse Educator (CNE) network, which will launch this week. The ... health care professionals to enhance the patient care experience by ... other health care professionals to help women who have been ... ...
Breaking Biology Technology: