Navigation Links
Mouse Anti-SLC22A3 Polyclonal Antibody, Unconjugated from Abnova Corporation

ProductsMouse Anti-SLC22A3 Polyclonal Antibody, Unconjugated from Abnova Corporation
Company Abnova Corporation
Item Mouse Anti-SLC22A3 Polyclonal Antibody, Unconjugated
Price 
Description Mouse polyclonal antibody raised against a partial recombinant SLC22A3.
Immunogen: SLC22A3 (NP_068812, 90 a.a. ~ 156 a.a) partial recombinant protein with GST tag.
Accession Number: NM_021977
Protein Sequence: CQRYLLEAANDSASATSALSCADPLAAFPNRSAPLVPCRGGWRYAQAHSTIVSEFDLVCVNAWMLD*
Info Abnova CorporationAbnova Corporation
Abnova Corporation (HQ)
9th Fl., No. 108, Jhouzih St.
Neihu District, Taipei
114 Taiwan R.O.C.
Tel: +886-2-8751-1888
Fax: +886-2-8751-1166

Abnova GmbH
Boxbergring 107
69126 Heidelberg
Germany
Tel: +49 6221 3632226
Fax: +49 6221 825878

Customer Service: +886-2-8751-1888
Fax Number: +886-2-8751-1166
Web Site: http://www.abnova.com.tw
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Mouse Anti-Amodiaquine Monoclonal Antibody, Unconjugated, Clone 6D10 from AntibodyShop A/S
2. Mouse Anti-Protein S Monoclonal Antibody, Unconjugated, Clone HYB 232-02 from Abcam
3. Mouse Anti-Mouse Glutathione S-transferase M1 (GSTM1) Monoclonal Antibody, Unconjugated from Lifespan Biosciences
4. Mouse Anti-Human S-100 alpha/beta chain Monoclonal Antibody, Unconjugated, Clone 8B10 from Santa Cruz Biotechnology, Inc.
5. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Testis from OriGene Technologies
6. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Brain (adult) from OriGene Technologies
7. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (12.5 - day) from OriGene Technologies
8. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (19 - day) from OriGene Technologies
9. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Thymus from OriGene Technologies
10. Mouse Anti-Human Complement factor B Monoclonal Antibody, Unconjugated, Clone 9B6 from AntibodyShop A/S
11. Mouse Anti-Human Choriongonadotropin (hCG) Monoclonal Antibody, Unconjugated, Clone 5F10 from AntibodyShop A/S
Mol wt: average mol wt16,951.27 Da by calculation...
... is the only PCR system that ensures ... time. It provides accuracy, consistency, and dependability ... the property of the DNA templates. This ... a unique blend of thermostable enzymes that ...
... C2C12 cells were cultured in DMEM and harvested ... order to keep the antigens in their native ... cells are arrayed on a 12-well (5 mm) ... treated to enhance cellular attachment and to minimize ...
... set-up Easy to assemble ... tubes, strips or Nunc 96 Well Amplifications ... tray can be fitted directly into the thermal cycler ... thermal cycler formats of major manufacturers Alphanumerically ...
Biology Products:
(Date:7/11/2014)... The Chinese University of Hong Kong, BGI and other ... to salt tolerance, with implication for improving this important ... online in Nature Communications provides an effective ... , Soybean is an important crop for the world. ... less genetic diversities than their wild counterparts. Among the ...
(Date:7/11/2014)... from the Max Planck Institute for Medical Research in ... understanding photosynthesis, the process by which the Earth first ... and which is therefore crucial for all higher forms ... the first direct visualization of a crucial event in ... specific protein complex, photosystem II, splits water into hydrogen ...
(Date:7/11/2014)... kidney injury related to the use of hydroxyethyl starch ... molecules, according to a report in Anesthesia & ... Society (IARS). , The "total mass of HES molecules" ... renal proximal tubule cells (PTCs), concludes the laboratory study ... Wrzburg, Austria. Other factorssuch as differences in the ...
Breaking Biology News(10 mins):BGI reports a novel gene for salt tolerance found in wild soybean 2A first direct glimpse of photosynthesis in action 2In lab studies, hydroxyethyl starch has direct harmful effects on kidney cells 2
... day of competition in London, a team of four ... emerged as the winners of this year,s Biotechnology Young ... Biotechnology Young Entrepreneurs Scheme (YES) competition are Ben Owens, ... University of Oxford. The team pitched their ...
... -- The International Center for Tropical Agriculture (CIAT) ... a collaborative agreement to sequence 5,000 cassava genotypes, ... wild species of the crop. Cassava is the ... developing countries (after maize, wheat and rice.) Results ...
... exploded in Yambuku, a remote village in Zaire, (now the ... Ebola had emerged, soon earning a grim distinction as one ... up to 90 percent of its victims, and producing a ... Charles Arntzen, a researcher at the Biodesign Institute at Arizona ...
Cached Biology News:Winning early-career researchers excel in entrepreneurship 2Winning early-career researchers excel in entrepreneurship 3BGI and CIAT announce collaboration for large-scale genome sequencing of cassava 2BGI and CIAT announce collaboration for large-scale genome sequencing of cassava 3Defensive measures: Toward a vaccine for Ebola 2Defensive measures: Toward a vaccine for Ebola 3Defensive measures: Toward a vaccine for Ebola 4Defensive measures: Toward a vaccine for Ebola 5
(Date:7/11/2014)... 2014 /CNW/ - Sunovion Pharmaceuticals Canada Inc. (Sunovion) today ... acetate) for use as a once-daily adjunctive therapy for ... who are not satisfactorily controlled with conventional therapy.  APTIOM ... under 18 years of age. Epilepsy ... according to Epilepsy Canada, it affects 0.6% of the ...
(Date:7/10/2014)... 2014 Women in the West ... an additional family planning option. Sayana® Press has ... all levels of the health system and in ... widely used contraceptive—Pfizer’s Depo-Provera® (depot medroxyprogesterone acetate)—with the ... the first of four African countries expected to ...
(Date:7/10/2014)... (PRWEB) July 10, 2014 Understanding the ... channel-expressing cell lines, and the gap that currently exists ... that expand its industry-leading portfolio of validated ion channel ... ion channel-expressing cell lines, as ion channels control many ... control this activity creates the potential to treat a ...
(Date:7/10/2014)... Robert Harman, DVM, Founder and CEO of Vet-Stem, Inc., ... the relaunch of his highly informative blog, now named Stem ... What are Stem Cells ?” Dr. Harman’s purpose for ... the basics of stem cell therapy so that pet owners ... treatment when considering regenerative medicine. , A veterinarian by trade, ...
Breaking Biology Technology:Sunovion Pharmaceuticals Canada Inc. Announces Health Canada Approval of APTIOM(TM) (eslicarbazepine acetate) as a Once-Daily Adjunctive Treatment for Partial-Onset Seizures in Patients with Epilepsy 2Sunovion Pharmaceuticals Canada Inc. Announces Health Canada Approval of APTIOM(TM) (eslicarbazepine acetate) as a Once-Daily Adjunctive Treatment for Partial-Onset Seizures in Patients with Epilepsy 3Sunovion Pharmaceuticals Canada Inc. Announces Health Canada Approval of APTIOM(TM) (eslicarbazepine acetate) as a Once-Daily Adjunctive Treatment for Partial-Onset Seizures in Patients with Epilepsy 4Injectable Contraceptive Launched in Burkina Faso to Expand Choice and Address Unmet Need 2Injectable Contraceptive Launched in Burkina Faso to Expand Choice and Address Unmet Need 3Injectable Contraceptive Launched in Burkina Faso to Expand Choice and Address Unmet Need 4Injectable Contraceptive Launched in Burkina Faso to Expand Choice and Address Unmet Need 5Injectable Contraceptive Launched in Burkina Faso to Expand Choice and Address Unmet Need 6Leader in Ion Channel Research Announces Newly Validated and Re-Engineered Cells 2Leader in Ion Channel Research Announces Newly Validated and Re-Engineered Cells 3Robert Harman, DVM Talks About What Stem Cells are in His Latest Blog Series for Vet-Stem, Inc. 2Robert Harman, DVM Talks About What Stem Cells are in His Latest Blog Series for Vet-Stem, Inc. 3