Navigation Links
Mouse Anti-SLC22A3 Polyclonal Antibody, Unconjugated from Abnova Corporation

ProductsMouse Anti-SLC22A3 Polyclonal Antibody, Unconjugated from Abnova Corporation
Company Abnova Corporation
Item Mouse Anti-SLC22A3 Polyclonal Antibody, Unconjugated
Price 
Description Mouse polyclonal antibody raised against a partial recombinant SLC22A3.
Immunogen: SLC22A3 (NP_068812, 90 a.a. ~ 156 a.a) partial recombinant protein with GST tag.
Accession Number: NM_021977
Protein Sequence: CQRYLLEAANDSASATSALSCADPLAAFPNRSAPLVPCRGGWRYAQAHSTIVSEFDLVCVNAWMLD*
Info Abnova CorporationAbnova Corporation
Abnova Corporation (HQ)
9th Fl., No. 108, Jhouzih St.
Neihu District, Taipei
114 Taiwan R.O.C.
Tel: +886-2-8751-1888
Fax: +886-2-8751-1166

Abnova GmbH
Boxbergring 107
69126 Heidelberg
Germany
Tel: +49 6221 3632226
Fax: +49 6221 825878

Customer Service: +886-2-8751-1888
Fax Number: +886-2-8751-1166
Web Site: http://www.abnova.com.tw
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Mouse Anti-Amodiaquine Monoclonal Antibody, Unconjugated, Clone 6D10 from AntibodyShop A/S
2. Mouse Anti-Protein S Monoclonal Antibody, Unconjugated, Clone HYB 232-02 from Abcam
3. Mouse Anti-Mouse Glutathione S-transferase M1 (GSTM1) Monoclonal Antibody, Unconjugated from Lifespan Biosciences
4. Mouse Anti-Human S-100 alpha/beta chain Monoclonal Antibody, Unconjugated, Clone 8B10 from Santa Cruz Biotechnology, Inc.
5. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Testis from OriGene Technologies
6. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Brain (adult) from OriGene Technologies
7. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (12.5 - day) from OriGene Technologies
8. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (19 - day) from OriGene Technologies
9. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Thymus from OriGene Technologies
10. Mouse Anti-Human Complement factor B Monoclonal Antibody, Unconjugated, Clone 9B6 from AntibodyShop A/S
11. Mouse Anti-Human Choriongonadotropin (hCG) Monoclonal Antibody, Unconjugated, Clone 5F10 from AntibodyShop A/S
... is designed for use with HRP conjugated rabbit ... mouse monoclonal coating antibody. • ... prevent non-specific binding between the coating and detection ... may be used to stabilize newly conjugated antibodies, ...
...
For cleavage of 6xHis tags from proteins containing a Factor Xa Protease recognition site Efficient 6xHis tag cleavage (greater than 90%), ...
HIV Reverse Transcriptase provides an excellent target for evaluating antiviral agents or catalyzing error prone synthesis on RNA and DNA templates....
Biology Products:
(Date:1/13/2016)... ALBANY, New York , January 13, 2016 /PRNewswire/ ... Transparency Market Research has published a new market report ... Share, Growth, Trends, and Forecast, 2015 - 2023. According to ... mn in 2014 and is anticipated to reach US$1,625.8 ... from 2015 to 2023. In terms of volume, the ...
(Date:1/11/2016)... 11, 2016 Synaptics Incorporated (NASDAQ: SYNA ... announced that its ClearPad ® TouchView ™ ... two separate categories in the 8 th Annual ... Technology Breakthrough. The Synaptics ® TDDI solution enables ... chain, thinner devices, brighter displays and borderless designs. ...
(Date:1/8/2016)... MANCHESTER, United Kingdom , Jan. 8, 2016   ... diagnostic products, today announced the closing of a $9 million ... Proceeds from the financing will be used to accelerate the ... for detecting early-stage pressure ulcers. United ... receiving CE Mark approval. The device,s introduction has been met ...
Breaking Biology News(10 mins):
(Date:2/4/2016)... 2016  Spherix Incorporated (Nasdaq: SPEX ) -- an intellectual ... of intellectual property, today provided an update on the ... District of Texas and announcing ... Inter Partes Re-examination ("IPR") proceedings that VTech and ... was initiated on only certain claims of two of ...
(Date:2/4/2016)... Brooklyn, NY (PRWEB) , ... February 04, 2016 , ... ... cuvettes for over 10 years. What sets them apart from other cuvette ... that is posted on their website. On top of this steady flow of ...
(Date:2/3/2016)... Feb. 3, 2016 Ascendis Pharma A/S (Nasdaq: ... applies its innovative TransCon technology to address significant unmet ... upcoming investor conference.Event:2016 Leerink Partners Global Healthcare Conference Location: ... Wednesday, February 10, 2016 Time:  , 11:55am EST ... --> An audio webcast of this event ...
(Date:2/3/2016)... ... February 03, 2016 , ... ... of potential targets (epitopes) specific to misfolded, propagating strains of Amyloid beta involved ... monoclonal antibody therapeutics for Alzheimer’s. , Following on from the first misfolded Amyloid ...
Breaking Biology Technology: