Navigation Links
Mouse Anti-SLC22A3 Polyclonal Antibody, Unconjugated from Abnova Corporation

ProductsMouse Anti-SLC22A3 Polyclonal Antibody, Unconjugated from Abnova Corporation
Company Abnova Corporation
Item Mouse Anti-SLC22A3 Polyclonal Antibody, Unconjugated
Price 
Description Mouse polyclonal antibody raised against a partial recombinant SLC22A3.
Immunogen: SLC22A3 (NP_068812, 90 a.a. ~ 156 a.a) partial recombinant protein with GST tag.
Accession Number: NM_021977
Protein Sequence: CQRYLLEAANDSASATSALSCADPLAAFPNRSAPLVPCRGGWRYAQAHSTIVSEFDLVCVNAWMLD*
Info Abnova CorporationAbnova Corporation
Abnova Corporation (HQ)
9th Fl., No. 108, Jhouzih St.
Neihu District, Taipei
114 Taiwan R.O.C.
Tel: +886-2-8751-1888
Fax: +886-2-8751-1166

Abnova GmbH
Boxbergring 107
69126 Heidelberg
Germany
Tel: +49 6221 3632226
Fax: +49 6221 825878

Customer Service: +886-2-8751-1888
Fax Number: +886-2-8751-1166
Web Site: http://www.abnova.com.tw
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Mouse Anti-Amodiaquine Monoclonal Antibody, Unconjugated, Clone 6D10 from AntibodyShop A/S
2. Mouse Anti-Protein S Monoclonal Antibody, Unconjugated, Clone HYB 232-02 from Abcam
3. Mouse Anti-Mouse Glutathione S-transferase M1 (GSTM1) Monoclonal Antibody, Unconjugated from Lifespan Biosciences
4. Mouse Anti-Human S-100 alpha/beta chain Monoclonal Antibody, Unconjugated, Clone 8B10 from Santa Cruz Biotechnology, Inc.
5. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Testis from OriGene Technologies
6. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Brain (adult) from OriGene Technologies
7. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (12.5 - day) from OriGene Technologies
8. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (19 - day) from OriGene Technologies
9. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Thymus from OriGene Technologies
10. Mouse Anti-Human Complement factor B Monoclonal Antibody, Unconjugated, Clone 9B6 from AntibodyShop A/S
11. Mouse Anti-Human Choriongonadotropin (hCG) Monoclonal Antibody, Unconjugated, Clone 5F10 from AntibodyShop A/S
... Each Signet Level 2 Detection System ... avidin-biotin chemical bonding principle and Signets ... provide sensitivity, specificity and reliablility. Signet ... in both manual and automated protocols. ...
XPMC2H Immunogen: XPMC2H (NP_065118, 323 a.a. ~ 423 a.a) partial recombinant protein with GST tag. Storage: -20 C, Avoid Freeze/Thaw Cycles *Available for distribution in the US only...
Ideally suited for resolving DNA and RNA 10-1000 bases especially PCR products ranging from 100-1000 bp. Gelling temp. (4%) 27C Melting temperature 65C. EEO: 0.10 Rnase/Dnase: none detected...
Xanthine Oxidase (Bovine Buttermilk). Monospecific by IEP. Some cross reactivity with Xanthine Oxidase of other species and tissues may occur....
Biology Products:
(Date:6/23/2017)... and ITHACA, N.Y. , June 23, ... University, a leader in dairy research, today announced a ... to help reduce the chances that the global milk ... of this dairy project, Cornell University has become the ... the Food Supply Chain, a food safety initiative that ...
(Date:5/23/2017)... 2017  Hunova, the first robotic gym for the rehabilitation and functional ... in Genoa, Italy . The first 30 robots will ... USA . The technology was developed and patented at ... IIT spin-off Movendo Technology thanks to a 10 million euro investment from ... click: ...
(Date:5/16/2017)... 16, 2017   Bridge Patient Portal , ... MD EMR Systems , an electronic medical ... GE, have established a partnership to build an ... the GE Centricity™ products, including Centricity Practice Solution ... These new integrations will allow healthcare delivery ...
Breaking Biology News(10 mins):
(Date:8/16/2017)... Ca (PRWEB) , ... August 16, 2017 , ... ... by changing into a different cell type. Many treatments for specific cancers, such ... prominent example of targeted treatment is androgen deprivation therapy for advanced prostate cancer. ...
(Date:8/16/2017)... OH (PRWEB) , ... August 16, 2017 , ... ... a beneficial microbe delivery system, announced it has secured $2M in funding from ... Queen City Angels, Carmen Innovations, and SVG Thrive Fund. With this investment, 3Bar ...
(Date:8/16/2017)... of the Inc. 5000 features a now-familiar name: BioPoint ( http://biopointinc.com/ ), ... for the third year in a row. Now in its 36th edition, ... set of quantitative metrics. In addition, BioPoint was also named to the ... Bay State . ... ...
(Date:8/15/2017)... STANFORD, Calif. , Aug. 15, 2017 After spending ... resources and support with crowdsourced data collection, GeneFo now offers this ... interested in aligning and amplifying support, adherence, and data collection vis ... with medical foundations mark the successful launch of this offer. ... GeneFo ...
Breaking Biology Technology: