Navigation Links
Mouse Anti-SLC22A3 Polyclonal Antibody, Unconjugated from Abnova Corporation

ProductsMouse Anti-SLC22A3 Polyclonal Antibody, Unconjugated from Abnova Corporation
Company Abnova Corporation
Item Mouse Anti-SLC22A3 Polyclonal Antibody, Unconjugated
Price 
Description Mouse polyclonal antibody raised against a partial recombinant SLC22A3.
Immunogen: SLC22A3 (NP_068812, 90 a.a. ~ 156 a.a) partial recombinant protein with GST tag.
Accession Number: NM_021977
Protein Sequence: CQRYLLEAANDSASATSALSCADPLAAFPNRSAPLVPCRGGWRYAQAHSTIVSEFDLVCVNAWMLD*
Info Abnova CorporationAbnova Corporation
Abnova Corporation (HQ)
9th Fl., No. 108, Jhouzih St.
Neihu District, Taipei
114 Taiwan R.O.C.
Tel: +886-2-8751-1888
Fax: +886-2-8751-1166

Abnova GmbH
Boxbergring 107
69126 Heidelberg
Germany
Tel: +49 6221 3632226
Fax: +49 6221 825878

Customer Service: +886-2-8751-1888
Fax Number: +886-2-8751-1166
Web Site: http://www.abnova.com.tw
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Mouse Anti-Amodiaquine Monoclonal Antibody, Unconjugated, Clone 6D10 from AntibodyShop A/S
2. Mouse Anti-Protein S Monoclonal Antibody, Unconjugated, Clone HYB 232-02 from Abcam
3. Mouse Anti-Mouse Glutathione S-transferase M1 (GSTM1) Monoclonal Antibody, Unconjugated from Lifespan Biosciences
4. Mouse Anti-Human S-100 alpha/beta chain Monoclonal Antibody, Unconjugated, Clone 8B10 from Santa Cruz Biotechnology, Inc.
5. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Testis from OriGene Technologies
6. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Brain (adult) from OriGene Technologies
7. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (12.5 - day) from OriGene Technologies
8. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (19 - day) from OriGene Technologies
9. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Thymus from OriGene Technologies
10. Mouse Anti-Human Complement factor B Monoclonal Antibody, Unconjugated, Clone 9B6 from AntibodyShop A/S
11. Mouse Anti-Human Choriongonadotropin (hCG) Monoclonal Antibody, Unconjugated, Clone 5F10 from AntibodyShop A/S
... Polymerase is a premium quality recombinant form ... enzyme is suitable for a wide range ... purity and reproducible performance, each preparation is ... control assays. NovaTaq DNA Polymerase possesses an ...
Mouse monoclonal antibody raised against a partial recombinant COG2. NCBI Entrez Gene ID = COG2...
Mouse monoclonal antibody raised against a full length recombinant LDB3. NCBI Entrez Gene ID = LDB3...
...
Biology Products:
(Date:1/11/2017)... 11, 2017  Michael Johnson, co-founder of Visikol Inc. a company ... has been named to the elite "Forbes 30 Under 30" list ... 600 people in 20 fields nationwide to be recognized as a ... applicants were selected. ... He is currently a PhD candidate at Rutgers University. ...
(Date:1/6/2017)... 5, 2017  Delta ID Inc., a leader in ... for automotive at CES® 2017. Delta ID has collaborated ... demonstrate the use of iris scanning as a secure, ... driver in a car, and as a way to ... Delta ID and Gentex will demonstrate (booth ...
(Date:1/3/2017)... 2017 Onitor, provider of digital health technology ... an innovative biometric data-driven program designed to aid weight ... the 2017 Consumer Electronics Show (CES) in ... U.S., the World Health Organization (WHO), have identified lifestyle ... who are overweight or obese. WHO also states that ...
Breaking Biology News(10 mins):
(Date:1/19/2017)... ... January 19, 2017 , ... ... the full spectrum of drug and device development, and Prism Clinical Research ... and clinicians, today announced Verified Clinical Trials (VCT) has been selected ...
(Date:1/19/2017)... BETHESDA, Md. , Jan. 18, 2017  Northwest ... company developing DCVax® personalized immune therapies for operable and ... Marnix Bosch , Chief Technical Officer of NW Bio, ... Thursday, January 19, 2017, at the Hyatt Regency Hotel ... Dr. Bosch will chair the session entitled "New Therapeutic ...
(Date:1/19/2017)... Jan. 18, 2017 BD (Becton, Dickinson and Company) (NYSE: ... that it will host a live webcast of its Annual Meeting ... The webcast can be accessed from the BD ... through Tuesday, January 31, 2017. ... About BD BD is a global medical ...
(Date:1/18/2017)... According to a new market research report "In situ Hybridization Market by Technique ... Diagnostic Laboratories, Academic and Research Institutions) - Global Forecast to 2021" published by ... USD 557.1 Million in 2016, growing at a CAGR of 5.8%. ... ... MarketsandMarkets Logo ...
Breaking Biology Technology: