Navigation Links
Mouse Anti-SLC22A3 Polyclonal Antibody, Unconjugated from Abnova Corporation

ProductsMouse Anti-SLC22A3 Polyclonal Antibody, Unconjugated from Abnova Corporation
Company Abnova Corporation
Item Mouse Anti-SLC22A3 Polyclonal Antibody, Unconjugated
Price 
Description Mouse polyclonal antibody raised against a partial recombinant SLC22A3.
Immunogen: SLC22A3 (NP_068812, 90 a.a. ~ 156 a.a) partial recombinant protein with GST tag.
Accession Number: NM_021977
Protein Sequence: CQRYLLEAANDSASATSALSCADPLAAFPNRSAPLVPCRGGWRYAQAHSTIVSEFDLVCVNAWMLD*
Info Abnova CorporationAbnova Corporation
Abnova Corporation (HQ)
9th Fl., No. 108, Jhouzih St.
Neihu District, Taipei
114 Taiwan R.O.C.
Tel: +886-2-8751-1888
Fax: +886-2-8751-1166

Abnova GmbH
Boxbergring 107
69126 Heidelberg
Germany
Tel: +49 6221 3632226
Fax: +49 6221 825878

Customer Service: +886-2-8751-1888
Fax Number: +886-2-8751-1166
Web Site: http://www.abnova.com.tw
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Mouse Anti-Amodiaquine Monoclonal Antibody, Unconjugated, Clone 6D10 from AntibodyShop A/S
2. Mouse Anti-Protein S Monoclonal Antibody, Unconjugated, Clone HYB 232-02 from Abcam
3. Mouse Anti-Mouse Glutathione S-transferase M1 (GSTM1) Monoclonal Antibody, Unconjugated from Lifespan Biosciences
4. Mouse Anti-Human S-100 alpha/beta chain Monoclonal Antibody, Unconjugated, Clone 8B10 from Santa Cruz Biotechnology, Inc.
5. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Testis from OriGene Technologies
6. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Brain (adult) from OriGene Technologies
7. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (12.5 - day) from OriGene Technologies
8. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (19 - day) from OriGene Technologies
9. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Thymus from OriGene Technologies
10. Mouse Anti-Human Complement factor B Monoclonal Antibody, Unconjugated, Clone 9B6 from AntibodyShop A/S
11. Mouse Anti-Human Choriongonadotropin (hCG) Monoclonal Antibody, Unconjugated, Clone 5F10 from AntibodyShop A/S
... Chemicon Select Tissue Arrays are intended for ... tissues were fixed in neutral buffered formalin ... and diagnosis was performed by certified pathologists. ... paraffin blocks and relocated into a new ...
... Kit contains in vitro synthesized, polyadenylated transcripts ... probes on Agilents microarrays, with minimal self- ... positive microarray control in the hybridization protocol. ... a required component of the Agilent One-Color ...
... industry standard microarray image analysis software because ... analysis tools, visualizations, automation capabilities, performance and ... with every GenePix scanner, and it also ... all types of arrays. A wide range ...
... is the one mouse-click image analysis ... protein/antibody. It is the solution for ... system images. MicroVigene is empowered with ... flexible grid, regional 2D-curve fitting background ...
Biology Products:
(Date:3/15/2016)... 15, 2016 Yissum Research Development Company ... company of the Hebrew University, announced today the formation ... technology of various human biological indicators. Neteera Technologies has ... from private investors. ... detection of electromagnetic emissions from sweat ducts, enables reliable ...
(Date:3/11/2016)... India , March 11, 2016 ... a new market research report "Image Recognition Market by ... Application (Marketing and Advertising), by Deployment Type (On-Premises and ... Forecast To 2022", published by MarketsandMarkets, the global market ... 2015 to USD 29.98 Billion by 2020, at a ...
(Date:3/9/2016)... 9, 2016 Nigeria ... more than 23,000 public service employees either did not ... their salary unlawfully.    --> Nigeria ... that more than 23,000 public service employees either did ... receiving their salary unlawfully.    --> DERMALOG, ...
Breaking Biology News(10 mins):
(Date:5/25/2016)... ... May 25, 2016 , ... ... issued by the Office of the National Coordinator for Health IT (ONC) outlining ... if clinically relevant data were available when and where it was needed. The ...
(Date:5/25/2016)... , ... May 25, 2016 , ... ... Food and Drug Administration (FDA) has granted the company’s orphan drug designation request ... second orphan drug designation granted by the FDA. , Spinocerebellar ataxia is ...
(Date:5/24/2016)... (PRWEB) , ... May 24, 2016 , ... ... a newly re-branded identity. The new Media Cybernetics corporate branding reflects a results-driven ... of imaging and image analysis. The re-branding components include a crisp, refreshed logo ...
(Date:5/23/2016)... , May 23, 2016 Oxitec CEO ... th at 10:15 a.m. ET before the United States ... genetically engineered mosquitos can play in controlling the spread of ... the Zika virus.      (Logo: http://photos.prnewswire.com/prnh/20150630/227348 ... mosquito with a self-limiting gene. Trials in Brazil ...
Breaking Biology Technology: