Navigation Links
Mouse Anti-SLC22A3 Polyclonal Antibody, Unconjugated from Abnova Corporation

ProductsMouse Anti-SLC22A3 Polyclonal Antibody, Unconjugated from Abnova Corporation
Company Abnova Corporation
Item Mouse Anti-SLC22A3 Polyclonal Antibody, Unconjugated
Price 
Description Mouse polyclonal antibody raised against a partial recombinant SLC22A3.
Immunogen: SLC22A3 (NP_068812, 90 a.a. ~ 156 a.a) partial recombinant protein with GST tag.
Accession Number: NM_021977
Protein Sequence: CQRYLLEAANDSASATSALSCADPLAAFPNRSAPLVPCRGGWRYAQAHSTIVSEFDLVCVNAWMLD*
Info Abnova CorporationAbnova Corporation
Abnova Corporation (HQ)
9th Fl., No. 108, Jhouzih St.
Neihu District, Taipei
114 Taiwan R.O.C.
Tel: +886-2-8751-1888
Fax: +886-2-8751-1166

Abnova GmbH
Boxbergring 107
69126 Heidelberg
Germany
Tel: +49 6221 3632226
Fax: +49 6221 825878

Customer Service: +886-2-8751-1888
Fax Number: +886-2-8751-1166
Web Site: http://www.abnova.com.tw
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Mouse Anti-Amodiaquine Monoclonal Antibody, Unconjugated, Clone 6D10 from AntibodyShop A/S
2. Mouse Anti-Protein S Monoclonal Antibody, Unconjugated, Clone HYB 232-02 from Abcam
3. Mouse Anti-Mouse Glutathione S-transferase M1 (GSTM1) Monoclonal Antibody, Unconjugated from Lifespan Biosciences
4. Mouse Anti-Human S-100 alpha/beta chain Monoclonal Antibody, Unconjugated, Clone 8B10 from Santa Cruz Biotechnology, Inc.
5. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Testis from OriGene Technologies
6. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Brain (adult) from OriGene Technologies
7. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (12.5 - day) from OriGene Technologies
8. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (19 - day) from OriGene Technologies
9. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Thymus from OriGene Technologies
10. Mouse Anti-Human Complement factor B Monoclonal Antibody, Unconjugated, Clone 9B6 from AntibodyShop A/S
11. Mouse Anti-Human Choriongonadotropin (hCG) Monoclonal Antibody, Unconjugated, Clone 5F10 from AntibodyShop A/S
pETDuet-1 is designed for the coexpression of two target genes....
Human IL-29/IFN-lambda 1 Biotinylated Affinity Purified PAb...
Mouse Laminin-1 MAb (Clone AL-3)...
Anti-Potassium Channel EAG-1 Immunogen: Synthetic peptide from the C-terminus of rat Kv10.1 (Accession Q63472). The immunogen sequence is identical in mouse and 14/16 residues identical in human...
Biology Products:
(Date:12/2/2016)... , December 1, 2016 ... type (Fingerprint, Voice), Future Technology (Iris Recognition System), ... Region - Global Forecast to 2021", published by ... 442.7 Million in 2016, and is projected to ... a CAGR of 14.06%.      (Logo: ...
(Date:11/30/2016)... CHICAGO , Nov. 30, 2016  higi ... a new partnership initiative targeting national brands, industry ... and reward their respective audiences for taking steps ... Since its inception in 2012, higi has built ... US, impacting over 38 million people who have ...
(Date:11/29/2016)... CANNES, France , November 29, 2016 Nearly ... Continue Reading ... ... System is part of an efficient Identity Management. (PRNewsFoto/DERMALOG Identification Systems) ... DERMALOG is Germany's largest Multi-Biometric ...
Breaking Biology News(10 mins):
(Date:12/8/2016)... ... December 08, 2016 , ... ... packaging for their exceptionally efficient human mesenchymal stem/stromal cell (hMSC) expansion medium. ... bioprocess media products engineered to radically streamline culture processes, minimize processing time, ...
(Date:12/8/2016)... , Dec. 8, 2016  Soligenix, Inc. ... biopharmaceutical company focused on developing and commercializing products ... unmet medical need, announced today the long-term follow-up ... SGX942 (dusquetide), a first-in-class Innate Defense Regulator (IDR), ... head and neck cancer patients undergoing chemoradiation therapy ...
(Date:12/8/2016)... , Dec. 8, 2016 Savannah ... remediation technologies and selected NewTechBio,s NT-MAX Lake ... microbial based beneficial bacteria, in conjunction with Hexa ... correct deficiencies with National Pollutant Discharge Elimination System ... has experienced a steady history of elevated pH ...
(Date:12/8/2016)...   Biocept, Inc . (NASDAQ: ... actionable liquid biopsy tests to improve the management ... its Target Selectorâ„¢ Circulating Tumor Cell platform demonstrated ... of actionable biomarkers in patients with metastatic breast ... Cannon Research Institute (SCRI), the research arm of ...
Breaking Biology Technology: