Navigation Links
Mouse Anti-SLC22A3 Polyclonal Antibody, Unconjugated from Abnova Corporation

ProductsMouse Anti-SLC22A3 Polyclonal Antibody, Unconjugated from Abnova Corporation
Company Abnova Corporation
Item Mouse Anti-SLC22A3 Polyclonal Antibody, Unconjugated
Price 
Description Mouse polyclonal antibody raised against a partial recombinant SLC22A3.
Immunogen: SLC22A3 (NP_068812, 90 a.a. ~ 156 a.a) partial recombinant protein with GST tag.
Accession Number: NM_021977
Protein Sequence: CQRYLLEAANDSASATSALSCADPLAAFPNRSAPLVPCRGGWRYAQAHSTIVSEFDLVCVNAWMLD*
Info Abnova CorporationAbnova Corporation
Abnova Corporation (HQ)
9th Fl., No. 108, Jhouzih St.
Neihu District, Taipei
114 Taiwan R.O.C.
Tel: +886-2-8751-1888
Fax: +886-2-8751-1166

Abnova GmbH
Boxbergring 107
69126 Heidelberg
Germany
Tel: +49 6221 3632226
Fax: +49 6221 825878

Customer Service: +886-2-8751-1888
Fax Number: +886-2-8751-1166
Web Site: http://www.abnova.com.tw
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Mouse Anti-Amodiaquine Monoclonal Antibody, Unconjugated, Clone 6D10 from AntibodyShop A/S
2. Mouse Anti-Protein S Monoclonal Antibody, Unconjugated, Clone HYB 232-02 from Abcam
3. Mouse Anti-Mouse Glutathione S-transferase M1 (GSTM1) Monoclonal Antibody, Unconjugated from Lifespan Biosciences
4. Mouse Anti-Human S-100 alpha/beta chain Monoclonal Antibody, Unconjugated, Clone 8B10 from Santa Cruz Biotechnology, Inc.
5. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Testis from OriGene Technologies
6. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Brain (adult) from OriGene Technologies
7. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (12.5 - day) from OriGene Technologies
8. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (19 - day) from OriGene Technologies
9. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Thymus from OriGene Technologies
10. Mouse Anti-Human Complement factor B Monoclonal Antibody, Unconjugated, Clone 9B6 from AntibodyShop A/S
11. Mouse Anti-Human Choriongonadotropin (hCG) Monoclonal Antibody, Unconjugated, Clone 5F10 from AntibodyShop A/S
... protein assay reagents package is used for determining ... and detergents. The RC DC protein assay is ... for 500 standard assays: 250 ml RC reagent ... alkaline copper tartrate solution, 2 L dilute Folin ...
... Kit is used in conjunction with the EasyCount ... automatically. The ViaSure Staining Reagent uses a ... Orange and Ethidium Bromide to identify live and ... the EasyCount Slide 6 Multi-well Slide provides ...
... Protein Precipitation Kit is designed for ... from aqueous samples. Proteomics sample analysis ... of non-protein impurities such as buffers, ... sample that interfere with electrophoretic separations ...
... Trans-Blot cell and PowerPac Basic power supply are ... The Mini Trans-Blot cell accommodates two 7.5 x ... cassettes, modular electrode assembly, Bio-Ice cooling unit, buffer ... pads. The PowerPac basic power supply, 100-120 and ...
Biology Products:
(Date:4/14/2016)... AVIV, Israel , April 14, 2016 ... Behavioral Authentication and Malware Detection, today announced the appointment ... already assumed the new role. Goldwerger,s leadership ... BioCatch, on the heels of the deployment of its ... addition, BioCatch,s behavioral biometric technology, which discerns unique cognitive ...
(Date:3/23/2016)... 23, 2016 ... Gesichts- und Stimmerkennung mit Passwörtern     ... MESG ), ein führender Anbieter digitaler ... mit SpeechPro zusammenarbeitet, um erstmals dessen Biometrietechnologie ... die Möglichkeit angeboten, im Rahmen mobiler Apps ...
(Date:3/17/2016)... ABI Research, the leader in transformative ... market will reach more than $30 billion by ... Consumer electronics, particularly smartphones, continue to boost the ... reach two billion shipments by 2021 at a ... Research Analyst at ABI Research. "Surveillance is also ...
Breaking Biology News(10 mins):
(Date:4/29/2016)... 2016 According to a ... "Separation Systems for Commercial Biotechnology Market - Global ... 2015 - 2023", the separation systems for commercial ... in 2014 and is projected to expand at ... to reach US$ 19,227.8 Mn in 2023. ...
(Date:4/29/2016)... -- Elekta is pleased to announce that ... treatment planning software, is available for clinical release. Real-world ... version 5.11 provides significant performance speed enhancements over prior ... four times faster than in previous versions of ... Monte Carlo algorithm, users can ...
(Date:4/28/2016)... ... April 28, 2016 , ... Next week on ... on its first-in-class technologies for tissue stem cell counting and expansion to gene-editing ... to Reprogramming & CRISPR-based Genome Engineering in Burlington, Massachusetts. , The attention of ...
(Date:4/27/2016)... ... April 27, 2016 , ... Shimadzu Scientific Instruments ... Spring 2016 Marijuana Business Conference and Expo. Shimadzu’s high-performance instruments enable laboratories to ... more. Expo attendees can stop by booth 1021 to learn how Shimadzu’s instruments ...
Breaking Biology Technology: