Navigation Links
Mouse Anti-SLC22A3 Polyclonal Antibody, Unconjugated from Abnova Corporation

ProductsMouse Anti-SLC22A3 Polyclonal Antibody, Unconjugated from Abnova Corporation
Company Abnova Corporation
Item Mouse Anti-SLC22A3 Polyclonal Antibody, Unconjugated
Price 
Description Mouse polyclonal antibody raised against a partial recombinant SLC22A3.
Immunogen: SLC22A3 (NP_068812, 90 a.a. ~ 156 a.a) partial recombinant protein with GST tag.
Accession Number: NM_021977
Protein Sequence: CQRYLLEAANDSASATSALSCADPLAAFPNRSAPLVPCRGGWRYAQAHSTIVSEFDLVCVNAWMLD*
Info Abnova CorporationAbnova Corporation
Abnova Corporation (HQ)
9th Fl., No. 108, Jhouzih St.
Neihu District, Taipei
114 Taiwan R.O.C.
Tel: +886-2-8751-1888
Fax: +886-2-8751-1166

Abnova GmbH
Boxbergring 107
69126 Heidelberg
Germany
Tel: +49 6221 3632226
Fax: +49 6221 825878

Customer Service: +886-2-8751-1888
Fax Number: +886-2-8751-1166
Web Site: http://www.abnova.com.tw
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Mouse Anti-Amodiaquine Monoclonal Antibody, Unconjugated, Clone 6D10 from AntibodyShop A/S
2. Mouse Anti-Protein S Monoclonal Antibody, Unconjugated, Clone HYB 232-02 from Abcam
3. Mouse Anti-Mouse Glutathione S-transferase M1 (GSTM1) Monoclonal Antibody, Unconjugated from Lifespan Biosciences
4. Mouse Anti-Human S-100 alpha/beta chain Monoclonal Antibody, Unconjugated, Clone 8B10 from Santa Cruz Biotechnology, Inc.
5. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Testis from OriGene Technologies
6. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Brain (adult) from OriGene Technologies
7. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (12.5 - day) from OriGene Technologies
8. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (19 - day) from OriGene Technologies
9. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Thymus from OriGene Technologies
10. Mouse Anti-Human Complement factor B Monoclonal Antibody, Unconjugated, Clone 9B6 from AntibodyShop A/S
11. Mouse Anti-Human Choriongonadotropin (hCG) Monoclonal Antibody, Unconjugated, Clone 5F10 from AntibodyShop A/S
... Agencourt offers quick turnaround sequencing of ... copy and high copy plasmids. Agencourt's world-class, ... million Phred20 bases per day. The ... Sequencing service are 24 48 hour ...
A component of the Acridinium protein labeling kit....
... microplate coating using advanced automated high throughput microplate processing equipment ... can also accommodate virtually any lot size of the following ... 8 and 12 well strips, ... 384 well microplate, ...
... Kits are based on well-established periodate ... consistent and reproducible. This kit contains ... protein or antibody, including ready-to-use buffers ... Activated HRP is supplied ready-to-use and ...
Biology Products:
(Date:6/11/2020)... ... June 08, 2020 , ... ... other protective measures to protect workers in the medical field. The face masks ... who valiantly risk their lives every day to provide healthcare to pregnant women. ...
(Date:6/5/2020)... ... ... Greffex, a pioneering vaccine and gene therapy company based in Houston, Texas, welcomes ... a global perspective to make an impact in a post pandemic world,” said Co-Chairman ... independent, director of the company. , “The Greffex board is excited to have Neil ...
(Date:5/28/2020)... ... May 27, 2020 , ... Today bioinformatics leader hc1® ... uniquely combines lab testing insights and hc1’s exclusive Local Risk Index in a ... safety of employees returning to the workplace. , “Some of the best ways ...
Breaking Biology News(10 mins):
(Date:6/11/2020)... ... June 09, 2020 , ... Reducing carbon emissions has been and will ... Agreement to stock market dips, ways to reduce CO2 is something we can’t avoid. ... Most of the biofuels being produced today are created from recycled cooking oil or ...
(Date:5/30/2020)... ... 29, 2020 , ... The Conference Forum is pleased to ... to the unique role of the Chief Medical Officer in the biotech industry. ... best practices and career development of CMOs and Heads of R&D from different ...
(Date:5/21/2020)... (PRWEB) , ... May 21, 2020 , ... ... of clinical trials will cause long-term harm , Contrary to conventional wisdom that ... Institute study finds many companies will emerge from the pandemic commercially weaker, ...
(Date:5/15/2020)... ... May 14, 2020 , ... ... (hMSC) working cell banks and hMSC bioprocess systems, today announced the launch ... of hMSC-derived extracellular vesicles (EVs). RoosterCollect™-EV-CC is the only system designed with ...
Breaking Biology Technology: