Navigation Links
Mouse Anti-SF3B2 Polyclonal Antibody, Unconjugated from Abnova Corporation

ProductsMouse Anti-SF3B2 Polyclonal Antibody, Unconjugated from Abnova Corporation
Company Abnova Corporation
Item Mouse Anti-SF3B2 Polyclonal Antibody, Unconjugated
Price 
Description Mouse polyclonal antibody raised against a partial recombinant SF3B2.
Immunogen: SF3B2 (NP_006833, 592 a.a. ~ 646 a.a) partial recombinant protein with GST tag.
Accession Number: NM_006842
Protein Sequence: YEGKEFETRLKEKKPGDLSDELRISLGMPVGPNAHKVPPPWLIAMQRYGPPPSY*
Info Abnova CorporationAbnova Corporation
Abnova Corporation (HQ)
9th Fl., No. 108, Jhouzih St.
Neihu District, Taipei
114 Taiwan R.O.C.
Tel: +886-2-8751-1888
Fax: +886-2-8751-1166

Abnova GmbH
Boxbergring 107
69126 Heidelberg
Germany
Tel: +49 6221 3632226
Fax: +49 6221 825878

Customer Service: +886-2-8751-1888
Fax Number: +886-2-8751-1166
Web Site: http://www.abnova.com.tw
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Mouse Anti-Amodiaquine Monoclonal Antibody, Unconjugated, Clone 6D10 from AntibodyShop A/S
2. Mouse Anti-Protein S Monoclonal Antibody, Unconjugated, Clone HYB 232-02 from Abcam
3. Mouse Anti-Mouse Glutathione S-transferase M1 (GSTM1) Monoclonal Antibody, Unconjugated from Lifespan Biosciences
4. Mouse Anti-Human S-100 alpha/beta chain Monoclonal Antibody, Unconjugated, Clone 8B10 from Santa Cruz Biotechnology, Inc.
5. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Testis from OriGene Technologies
6. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Brain (adult) from OriGene Technologies
7. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (12.5 - day) from OriGene Technologies
8. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (19 - day) from OriGene Technologies
9. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Thymus from OriGene Technologies
10. Mouse Anti-Human Complement factor B Monoclonal Antibody, Unconjugated, Clone 9B6 from AntibodyShop A/S
11. Mouse Anti-Human Choriongonadotropin (hCG) Monoclonal Antibody, Unconjugated, Clone 5F10 from AntibodyShop A/S
... EasyCount System is a fluorescent microscopy-based imaging ... nucleated cells and automatically calculates cell viability, ... this routine function, the variability associated with ... be eliminated. Using the EasyCount ViaSure Kit, ...
In Western blotting antibodies recognize 94 K protein band, which corresponds to S-layer protein...
... inhibits protein synthesis. Acts by inhibiting ... Reported to induce apoptosis in a ... cells, Jurkat cells, ventricular myocytes, and ... and immediate early gene induction. Selective ...
5X StabilCoat Immunoassay Stabilizer is a 5X concentrate solution of StabilCoat Immunoassay Stabilizer. The shelf-life of 5X StabilCoat Immunoassay Stabilizer is 2 years when stored at 4C. Product ...
Biology Products:
(Date:5/3/2016)... Lithuania , May 3, 2016  Neurotechnology, ... released the MegaMatcher Automated Biometric Identification System ... of large-scale multi-biometric projects. MegaMatcher ABIS can process ... accuracy using any combination of fingerprint, face or ... MegaMatcher SDK and MegaMatcher Accelerator ...
(Date:4/26/2016)... -- Research and Markets has announced the ...  report to their offering.  , ,     (Logo: ... forecast the global multimodal biometrics market to grow ... 2016-2020.  Multimodal biometrics is being implemented ... healthcare, BFSI, transportation, automotive, and government for controlling ...
(Date:4/14/2016)... , April 14, 2016 ... Malware Detection, today announced the appointment of Eyal ... new role. Goldwerger,s leadership appointment comes at ... heels of the deployment of its platform at several ... biometric technology, which discerns unique cognitive and physiological factors, ...
Breaking Biology News(10 mins):
(Date:6/27/2016)... ... 27, 2016 , ... Rolf K. Hoffmann, former senior vice ... University of North Carolina Kenan-Flagler Business School effective June 27. , ... with a focus on the school’s international efforts, leading classes and participating in ...
(Date:6/24/2016)... June 24, 2016 Epic Sciences unveiled ... cancers susceptible to PARP inhibitors by targeting homologous ... (CTCs). The new test has already been incorporated ... multiple cancer types. Over 230 clinical ... response pathways, including PARP, ATM, ATR, DNA-PK and ...
(Date:6/23/2016)... ... June 23, 2016 , ... UAS ... the launch of their brand, UP4™ Probiotics, into Target stores nationwide. The company, ... proud to add Target to its list of well-respected retailers. This list includes ...
(Date:6/23/2016)... 23, 2016 Houston Methodist Willowbrook Hospital ... Sports Association to serve as their official health ... Methodist Willowbrook will provide sponsorship support, athletic training ... association coaches, volunteers, athletes and families. ... Sports Association and to bring Houston Methodist quality ...
Breaking Biology Technology: