Mouse Anti-SF3B2 Polyclonal Antibody, Unconjugated from Abnova Corporation

Request Info...

... Origami host strains are K-12 derivatives ... reductase (trxB) and glutathione reductase (gor) genes, ... the cytoplasm. Studies have shown that expression ... than in another host even though overall ...

Request Info...

Recommend to use at 1000X dilutions for cell culture (e.g. Add 1 ul to 1 ml of culture medium.)...

Biology Products:

Streptavidin, Fluorescein conjugated/tagged from R&D Systems Origami(DE3)pLysS Glycerol Stock from Novagen Mounting Medium from R&D Systems Caspase-6 Inhibitor Z-VEID-FMK from BioVision

(Date:5/23/2013)... per year, carrying more than 284 million tons of cargo, ... dollars in toll fees for the Panama Canal Authority. Each ... of water are used from Gatun Lake, which is also ... in the isthmus. , However, the advent of very ... the ships at sea, has demanded change. The Panama Canal ...

(Date:5/23/2013)... around nucleosomes in the cell nucleus makes it ... (LMU) in Munich now describes a mechanism that ... nucleosomes for transcription. , In higher organisms the ... wrapped around disk-shaped particles called nucleosomes, each consisting ... and accommodating two loops of DNA. Packed in ...

(Date:5/23/2013)... (May 23, 2013) A new report from the ... helping pupils engage in at least 60 minutes of ... , No more than half of American youth meet ... vigorous or moderate intensity physical activity daily, according to ... children are in school for nearly half of their ...

Breaking Biology News(10 mins):Reforestation study shows trade-offs between water, carbon and timber 2 Reforestation study shows trade-offs between water, carbon and timber 3 Biochemistry: Unspooling DNA from nucleosomal disks 2 Schools should provide students with daily physical activity, IOM recommends 2

[0] Reforestation study shows trade-offs between water, carbon and timber [0] Biochemistry: Unspooling DNA from nucleosomal disks [0] Schools should provide students with daily physical activity, IOM recommends

... world,s largest ocean research program, has expanded its ... Australia, India, and New Zealand as its newest ... agreed upon in a memorandum signed by Australia ... of Education, Culture, Sports, Science and Technology (MEXT); ...

... 2009) Cell Press, an imprint of Elsevier, announced today ... Current Biology and The American Journal of ... (SLA) Top 100 Journals in Biology and Medicine of the ... the 680-plus members of the SLA,s Biomedical and Life Sciences ...

... London have signed an agreement on 6 April ... to offer highly attractive joint Doctor of Philosophy ... The NTU-Imperial College Joint PhD degree programme will ... and Biomolecular Engineering. It will subsequently be extended ...

Cached Biology News:Australia, India, New Zealand join integrated ocean drilling program 2 Three prominent Cell Press journals named among the 100 most influential journals in past 100 years 2 Imperial College London and NTU collaborate to offer joint Ph.D. programs in engineering and science 2

Australia, India, New Zealand join integrated ocean drilling program Three prominent Cell Press journals named among the 100 most influential journals in past 100 years Imperial College London and NTU collaborate to offer joint Ph.D. programs in engineering and science

(Date:5/23/2013)... Bed bugs already cost Alton Housing Authority thousands. ... a report from kmov.com suggested that the said office might ... Meanwhile, to be of help, My Cleaning Products gave tips ... bug exterminator service. , The report, which was posted ... spent $35,000 for bed bug elimination, My Cleaning ...

(Date:5/23/2013)... 2013 Just released this month on Amazon ... author Barbara Roche: “Commit to Confidence: 30 Strategies to ... helpful tips and quotes from the fields of psychology and ... exercises that readers can do on their own or with ... personal and professional goals. , “My book is ...

(Date:5/22/2013)... 22, 2013 Cambridge Semantics was ... week’s “Data Demonstration Day” on Capitol Hill, hosted by The ... Google, Microsoft and others to showcase how innovative data management ... and Transparency Act (DATA Act). , Originally introduced in 2011 ... and Sen. Mark Warner (D-VA ), the ...

(Date:5/22/2013)... , May 22, 2013 Superior Controls, Inc. ... 2013" by Business NH Magazine. For the past ... organizations that distinguish themselves with extraordinary business and ... to receive this honor," said Rick ... with any recognition, this award is a reflection ...

Breaking Biology Technology:Bed Bug Exterminator Service Could Cost AHA $250K, My Cleaning Products Gives Tips How to Save Apartments from Costly Bed Bug Treatment 2 Cambridge Semantics Underscores Need for Smart Data during “Data Demonstration Day” on Capitol Hill 2 Superior Controls of Seabrook, NH named Business of the Year for 2013 by Business NH Magazine 2

[0] Bed Bug Exterminator Service Could Cost AHA $250K, My Cleaning Products Gives Tips How to Save Apartments from Costly Bed Bug Treatment [0] "Commit to Confidence" Hits Amazon and Barnes & Noble [0] Cambridge Semantics Underscores Need for Smart Data during “Data Demonstration Day” on Capitol Hill [0] Superior Controls of Seabrook, NH named Business of the Year for 2013 by Business NH Magazine

Products	Mouse Anti-SF3B2 Polyclonal Antibody, Unconjugated from Abnova Corporation
Company	Abnova Corporation
Item	Mouse Anti-SF3B2 Polyclonal Antibody, Unconjugated
Price
Description	Mouse polyclonal antibody raised against a partial recombinant SF3B2. Immunogen: SF3B2 (NP_006833, 592 a.a. ~ 646 a.a) partial recombinant protein with GST tag. Accession Number: NM_006842 Protein Sequence: YEGKEFETRLKEKKPGDLSDELRISLGMPVGPNAHKVPPPWLIAMQRYGPPPSY*
Info	Abnova Corporation Abnova Corporation (HQ) 9th Fl., No. 108, Jhouzih St. Neihu District, Taipei 114 Taiwan R.O.C. Tel: +886-2-8751-1888 Fax: +886-2-8751-1166 Abnova GmbH Boxbergring 107 69126 Heidelberg Germany Tel: +49 6221 3632226 Fax: +49 6221 825878 Customer Service: +886-2-8751-1888 Fax Number: +886-2-8751-1166 Web Site: http://www.abnova.com.tw