Navigation Links
Mouse Anti-SF3B2 Polyclonal Antibody, Unconjugated from Abnova Corporation

ProductsMouse Anti-SF3B2 Polyclonal Antibody, Unconjugated from Abnova Corporation
Company Abnova Corporation
Item Mouse Anti-SF3B2 Polyclonal Antibody, Unconjugated
Price 
Description Mouse polyclonal antibody raised against a partial recombinant SF3B2.
Immunogen: SF3B2 (NP_006833, 592 a.a. ~ 646 a.a) partial recombinant protein with GST tag.
Accession Number: NM_006842
Protein Sequence: YEGKEFETRLKEKKPGDLSDELRISLGMPVGPNAHKVPPPWLIAMQRYGPPPSY*
Info Abnova CorporationAbnova Corporation
Abnova Corporation (HQ)
9th Fl., No. 108, Jhouzih St.
Neihu District, Taipei
114 Taiwan R.O.C.
Tel: +886-2-8751-1888
Fax: +886-2-8751-1166

Abnova GmbH
Boxbergring 107
69126 Heidelberg
Germany
Tel: +49 6221 3632226
Fax: +49 6221 825878

Customer Service: +886-2-8751-1888
Fax Number: +886-2-8751-1166
Web Site: http://www.abnova.com.tw
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Mouse Anti-Amodiaquine Monoclonal Antibody, Unconjugated, Clone 6D10 from AntibodyShop A/S
2. Mouse Anti-Protein S Monoclonal Antibody, Unconjugated, Clone HYB 232-02 from Abcam
3. Mouse Anti-Mouse Glutathione S-transferase M1 (GSTM1) Monoclonal Antibody, Unconjugated from Lifespan Biosciences
4. Mouse Anti-Human S-100 alpha/beta chain Monoclonal Antibody, Unconjugated, Clone 8B10 from Santa Cruz Biotechnology, Inc.
5. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Testis from OriGene Technologies
6. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Brain (adult) from OriGene Technologies
7. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (12.5 - day) from OriGene Technologies
8. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (19 - day) from OriGene Technologies
9. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Thymus from OriGene Technologies
10. Mouse Anti-Human Complement factor B Monoclonal Antibody, Unconjugated, Clone 9B6 from AntibodyShop A/S
11. Mouse Anti-Human Choriongonadotropin (hCG) Monoclonal Antibody, Unconjugated, Clone 5F10 from AntibodyShop A/S
... White crystalline solid. PACKAGED UNDER ... Contaminants: DNases, proteases, RNases: none ... nm): ≤0.500; (100 mM, 1 cm, 280 ... Soluble in H 2 O. RTECS ...
... Genome ChIP-on-chip Microarray is specifically designed ... cerevisiae) DNA binding proteins by pairing ... microarrays. This set delivers robust hybridization ... true binding events and fewer false ...
... Salmonella genomes has allowed the development of ... pairs. The S. enterica Typhimurium (strain LT2) ... bp; 4,440 ORFs) and a plasmid, pSLT ... Sigma-Genosys have been designed to amplify all ...
... productivity and allows you to achieve a higher ... beyond traditional paper-based weighing processes into a powerful ... Control of ... PR, SR, PG-S, PG, SG, AT, MT, UMT, ...
Biology Products:
(Date:6/17/2015)... Germany , June 17, 2015 ... QIA) today launched new Investigator ® STR assay kits ... the United States . The new genetic fingerprint ... genomic markers (short tandem repeats or STRs) for DNA matching. ... the quality of DNA in each sample, a novel QIAGEN ...
(Date:6/16/2015)... , June 16, 2015 /CNW Telbec/ - ... partnership centralized around the incorporation of handyem,s HPC-150 ... diagnostic laboratory, the Mo-POD™. This unprecedented model of ... International Conference at the Pennsylvania ... from June 15 th to 18 th ...
(Date:6/16/2015)... GOTHENBURG, Sweden , June 16, 2015 ... 2015 from previously communicated that it will amount to at ... 390 MSEK. Due to the rapid increase in market growth ... from the previously communicated guidance that revenue for 2015 will ... 2015 will amount to approximately 2,200 MSEK. Due ...
Breaking Biology News(10 mins):QIAGEN Launches New Genetic Fingerprinting Kits for U.S. Forensic Labs 2QIAGEN Launches New Genetic Fingerprinting Kits for U.S. Forensic Labs 3QIAGEN Launches New Genetic Fingerprinting Kits for U.S. Forensic Labs 4QIAGEN Launches New Genetic Fingerprinting Kits for U.S. Forensic Labs 5handyem and FlowMetric Diagnostics announce their partnership in the development of Flow Cytometry- Based Solutions in diagnostic capabilities 2handyem and FlowMetric Diagnostics announce their partnership in the development of Flow Cytometry- Based Solutions in diagnostic capabilities 3Fingerprint Cards Raises the Revenue Guidance for Q2 2015 and for the Full Year 2015 2Fingerprint Cards Raises the Revenue Guidance for Q2 2015 and for the Full Year 2015 3
... Nitrous oxide is a potent greenhouse gas and a ... the ozone. Intensively managed, grazed pastures are responsible for ... excrement. Biochar is potentially a mitigation option for reducing ... carbon can be sequestered in the soil. Biochar also ...
... 17, 2011 (BRONX, NY) Researchers at Albert ... that members of an enzyme family found in humans and ... in regulating cell motility. Their findings suggest an entirely new ... cancer. , David Sharp, Ph.D. , associate professor of ...
... now lives in cities, yet we know little about how ... kind, ecologists in Indianapolis, USA have used 70 year-old dried ... plants. The results are published this week in the British ... Dr Rebecca Dolan, director of the Friesner Herbarium, Butler University, ...
Cached Biology News:Can biochar help suppress greenhouse gases? 2Enzyme can steer cells or possibly stop them in their tracks 2Ecologists use 70-year-old pressed plants to chart city's vanishing native flora 2
(Date:6/30/2015)... Kjell Lindgren , who is making final preparations for ... International Space Station , will be available for live ... 7. Lindgren will participate from the Gagarin Cosmonaut ... The interviews will be preceded at 7:30 a.m. by a ... To schedule an interview, media must contact Stephanie Stoll ...
(Date:6/30/2015)... Americord Registry, one of the fastest growing cord blood banks ... at Kirkland & Ellis LLP, as the newest member of ...   "We are thrilled about Andrew Horne,s ... , CEO of Americord. "He brings a wealth of knowledge ... growth and vision." Andrew Horne is ...
(Date:6/30/2015)... ... 2015 , ... With its latest polyacrylonitrile (PAN) membrane, Sterlitech ... flow rates in comparison to nylon or polyethersulfone (PES). Its unique nanofiber ... liquid flow while trapping particulates as small as 0.2 micron in width. , ...
(Date:6/30/2015)... ... June 30, 2015 , ... The maximum number of shares ... outstanding common shares (including shares of unvested restricted stock). On June 29, 2015, the ... price of Cryo-Cell’s shares reported on the OTCBB was $2.29 per share. , The ...
Breaking Biology Technology:NASA Astronaut Preps for First Space Station Mission, Available for Media Interviews 2Americord Registry Announces Andrew Horne as Advisory Board Member 2New Nanofiber Membrane Provides Fast, Efficient Filtration 2Cryo-Cell Commences Tender Offer to Purchase its Common Stock, Up to 750,000 Shares at $3.25 per Share 2Cryo-Cell Commences Tender Offer to Purchase its Common Stock, Up to 750,000 Shares at $3.25 per Share 3