Navigation Links
Mouse Anti-SF3B2 Polyclonal Antibody, Unconjugated from Abnova Corporation

ProductsMouse Anti-SF3B2 Polyclonal Antibody, Unconjugated from Abnova Corporation
Company Abnova Corporation
Item Mouse Anti-SF3B2 Polyclonal Antibody, Unconjugated
Price 
Description Mouse polyclonal antibody raised against a partial recombinant SF3B2.
Immunogen: SF3B2 (NP_006833, 592 a.a. ~ 646 a.a) partial recombinant protein with GST tag.
Accession Number: NM_006842
Protein Sequence: YEGKEFETRLKEKKPGDLSDELRISLGMPVGPNAHKVPPPWLIAMQRYGPPPSY*
Info Abnova CorporationAbnova Corporation
Abnova Corporation (HQ)
9th Fl., No. 108, Jhouzih St.
Neihu District, Taipei
114 Taiwan R.O.C.
Tel: +886-2-8751-1888
Fax: +886-2-8751-1166

Abnova GmbH
Boxbergring 107
69126 Heidelberg
Germany
Tel: +49 6221 3632226
Fax: +49 6221 825878

Customer Service: +886-2-8751-1888
Fax Number: +886-2-8751-1166
Web Site: http://www.abnova.com.tw
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Mouse Anti-Amodiaquine Monoclonal Antibody, Unconjugated, Clone 6D10 from AntibodyShop A/S
2. Mouse Anti-Protein S Monoclonal Antibody, Unconjugated, Clone HYB 232-02 from Abcam
3. Mouse Anti-Mouse Glutathione S-transferase M1 (GSTM1) Monoclonal Antibody, Unconjugated from Lifespan Biosciences
4. Mouse Anti-Human S-100 alpha/beta chain Monoclonal Antibody, Unconjugated, Clone 8B10 from Santa Cruz Biotechnology, Inc.
5. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Testis from OriGene Technologies
6. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Brain (adult) from OriGene Technologies
7. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (12.5 - day) from OriGene Technologies
8. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (19 - day) from OriGene Technologies
9. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Thymus from OriGene Technologies
10. Mouse Anti-Human Complement factor B Monoclonal Antibody, Unconjugated, Clone 9B6 from AntibodyShop A/S
11. Mouse Anti-Human Choriongonadotropin (hCG) Monoclonal Antibody, Unconjugated, Clone 5F10 from AntibodyShop A/S
(Date:12/17/2014)... Dec. 16, 2014 Research and Markets ... of the "Global Chemical Sensor Market 2015-2019" ... http://photos.prnewswire.com/prnh/20130307/600769 One major ... demand for medical sensors in biomedical applications. Chemical ... quick and correct diagnosis during surgical procedures. The ...
(Date:12/11/2014)... WINSTON SALEM, N.C. , Dec. 10, 2014  That ... known for quite a while. Hypertension – the medical term ... disease in the early 1800s, and the inflatable cuff that,s ... That doesn,t, however, mean there,s nothing new about hypertension, ... punctured some long-held beliefs about the condition and the best ...
(Date:12/10/2014)... 2014 CIE San Diego has launched an ... connective tissue that enhances care coordination among social service ... client-level information; earned a second $1 million grant from ... seniors aging in community and; will be recognized as ... th 4-6p. CIE San Diego today ...
Breaking Biology News(10 mins):Global Chemical Sensor Market 2015-2019: Key Vendors are Abbott Laboratories, Bayer, Hoffmann La-Roche, Johnson & Johnson, NGK Spark Plugs and Robert Bosch 2Research points to need for new approaches to treatment of high blood pressure 2Research points to need for new approaches to treatment of high blood pressure 3Research points to need for new approaches to treatment of high blood pressure 4Community Information Exchange San Diego Launches Pilot, Secures $1 Million Expansion Grant, and Becomes a "Live Well San Diego" Partner 2Community Information Exchange San Diego Launches Pilot, Secures $1 Million Expansion Grant, and Becomes a "Live Well San Diego" Partner 3Community Information Exchange San Diego Launches Pilot, Secures $1 Million Expansion Grant, and Becomes a "Live Well San Diego" Partner 4
... MADISON Denizens of oceans, lakes and even ... in intricately patterned, glass-like shells. Curiously, these tiny phytoplankton ... chips., Diatoms build their hard cell walls by laying ... the key material of the semiconductor industrysilicon. If we ...
... of Exeter has highlighted the problems of reintroducing ... online in the journal Biological Conservation, the research ... that are released into their natural habitats. On ... in the wild, with most deaths related to ...
... This release is available in French and ... Scherrer Institute (PSI) and the EPFL in Switzerland have ... at wavelengths used in typical medical and industrial imaging ... x-ray radiographs and could be used to diagnose the ...
Cached Biology News:In diatom, scientists find genes that may level engineering hurdle 2Captive carnivores not up to wild living 2New technology sharpens X-ray vision 2
(Date:12/17/2014)... , Dec. 17, 2014 CASI Pharmaceuticals, Inc. ... to the acquisition, development and commercialization of innovative therapeutics ... global market with a primary commercial focus on ... been granted a Type C meeting with the U.S. ... will be held in February 2015.  During this meeting ...
(Date:12/15/2014)... 15, 2014 METTLER TOLEDO is ... tool, ParticleView V19 with PVM technology , ... particle vision and measurement tool continuously captures high-resolution ... ParticleView V19 then automatically prepares a report pairing ... size and concentration changes. This compelling blend of ...
(Date:12/15/2014)... 15, 2014  GlassesOff Inc. (OTCBB: GLSO) announced today ... an independent director of the Company,s Board of Directors. ... served as its CEO until its acquisition by ... million transaction. Recognized as the inventor of the first ... provided Wi-Fi -based RFID solutions focused on improving operational ...
(Date:12/13/2014)... CanDiag, Inc., a University of North Carolina ... name to OncoTab, Inc. , “The new name ... today,” said CEO and Chief Science Officer, Dr. Pinku ... cancer diagnostics to include imaging and therapies, and our ... Founded in 2011 by Dr. Mukherjee, an Irwin Belk ...
Breaking Biology Technology:CASI Pharmaceuticals Granted Type C Meeting With U.S. FDA For ENMD-2076 In Fibrolamellar Carcinoma 2CASI Pharmaceuticals Granted Type C Meeting With U.S. FDA For ENMD-2076 In Fibrolamellar Carcinoma 3CASI Pharmaceuticals Granted Type C Meeting With U.S. FDA For ENMD-2076 In Fibrolamellar Carcinoma 4CASI Pharmaceuticals Granted Type C Meeting With U.S. FDA For ENMD-2076 In Fibrolamellar Carcinoma 5New Real-Time In Situ Probe-Based Video Microscope from METTLER TOLEDO 2AeroScout Founder Joins GlassesOff's Board of Directors 2AeroScout Founder Joins GlassesOff's Board of Directors 3CanDiag Inc. Expands Product Scope Under a New Name: OncoTab, Inc. 2