Navigation Links
Mouse Anti-SF3B2 Polyclonal Antibody, Unconjugated from Abnova Corporation

ProductsMouse Anti-SF3B2 Polyclonal Antibody, Unconjugated from Abnova Corporation
Company Abnova Corporation
Item Mouse Anti-SF3B2 Polyclonal Antibody, Unconjugated
Price 
Description Mouse polyclonal antibody raised against a partial recombinant SF3B2.
Immunogen: SF3B2 (NP_006833, 592 a.a. ~ 646 a.a) partial recombinant protein with GST tag.
Accession Number: NM_006842
Protein Sequence: YEGKEFETRLKEKKPGDLSDELRISLGMPVGPNAHKVPPPWLIAMQRYGPPPSY*
Info Abnova CorporationAbnova Corporation
Abnova Corporation (HQ)
9th Fl., No. 108, Jhouzih St.
Neihu District, Taipei
114 Taiwan R.O.C.
Tel: +886-2-8751-1888
Fax: +886-2-8751-1166

Abnova GmbH
Boxbergring 107
69126 Heidelberg
Germany
Tel: +49 6221 3632226
Fax: +49 6221 825878

Customer Service: +886-2-8751-1888
Fax Number: +886-2-8751-1166
Web Site: http://www.abnova.com.tw
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Mouse Anti-Amodiaquine Monoclonal Antibody, Unconjugated, Clone 6D10 from AntibodyShop A/S
2. Mouse Anti-Protein S Monoclonal Antibody, Unconjugated, Clone HYB 232-02 from Abcam
3. Mouse Anti-Mouse Glutathione S-transferase M1 (GSTM1) Monoclonal Antibody, Unconjugated from Lifespan Biosciences
4. Mouse Anti-Human S-100 alpha/beta chain Monoclonal Antibody, Unconjugated, Clone 8B10 from Santa Cruz Biotechnology, Inc.
5. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Testis from OriGene Technologies
6. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Brain (adult) from OriGene Technologies
7. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (12.5 - day) from OriGene Technologies
8. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (19 - day) from OriGene Technologies
9. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Thymus from OriGene Technologies
10. Mouse Anti-Human Complement factor B Monoclonal Antibody, Unconjugated, Clone 9B6 from AntibodyShop A/S
11. Mouse Anti-Human Choriongonadotropin (hCG) Monoclonal Antibody, Unconjugated, Clone 5F10 from AntibodyShop A/S
... component of the COP9 signalosome complex (CSN), ... developmental processes. The CSN complex is an ... pathway by mediating the deneddylation of the ... The complex is also involved in phosphorylation ...
... detection systems provide linking and labelling ... species specific primary antibodies for visualising ... is accomplished using an ultra-sensitive indirect ... labelling technology. Secondary antibodies are polymerised ...
Request Info...
Our original highly-purified, robust Taq Polymerase which delivers consistently high yields and minimal background...
Biology Products:
(Date:2/7/2017)... , Feb. 7, 2017 Zimmer Biomet Holdings, ... musculoskeletal healthcare, will present at the LEERINK Partners 6th ... Palace Hotel on Wednesday, February 15, 2017 at 10 ... of the presentation can be accessed at http://wsw.com/webcast/leerink28/zbh ... the conference via Zimmer Biomet,s Investor Relations website at ...
(Date:2/6/2017)... DENVER , Feb. 6, 2017 ... national security are driving border authorities to continue ... Acuity reports there are 2143 Automated Border Control ... Kiosks currently deployed at more than 163 ports ... between 2013 to 2016 achieving a combined CAGR ...
(Date:2/3/2017)... , Feb. 3, 2017 A new ... Identity Strategy Partners, LLP (IdSP) . Designed to fill ... the complex identity market, founding partners Mark Crego ... 35 combined years just in identity expertise that span ... and non-profit leadership. The Crego-Kephart combined expertise has a ...
Breaking Biology News(10 mins):
(Date:3/1/2017)... NEW YORK , March 1, 2017 /PRNewswire/ ... Company), a late-stage biopharmaceutical company developing novel cancer ... today reported updated positive Phase II data from ... myeloma (MM) patients. Consistent with preliminary data, the ... high-risk MM patients, positioning galinpepimut-S as a potential ...
(Date:3/1/2017)... Fla. , March 1, 2017  Friends, family, ... living with multiple sclerosis (MS), a chronic condition affecting ... MSWorld , MS Views and News , ... the Multiple Sclerosis Foundation — have joined biotechnology ... partners through the #MySupportHero initiative. During MS Awareness Month, ...
(Date:3/1/2017)... ... March 01, 2017 , ... Morris South ( http://www.morrissouth.com ... and open house, Southern Tech Fest, April 4-5 in Huntsville, Alabama. The regional ... Chiron and perform live metal cutting demonstrations throughout the event. More than 20 ...
(Date:2/28/2017)... ... February 28, 2017 , ... ... and instruments for sensitive, label-free biomolecular interaction analysis, has announced collaborations with ... Japan. The collaborators expect rapid and effective screening and ranking of inhibitors, ...
Breaking Biology Technology: