Navigation Links
Mouse Anti-SF3B2 Polyclonal Antibody, Unconjugated from Abnova Corporation

ProductsMouse Anti-SF3B2 Polyclonal Antibody, Unconjugated from Abnova Corporation
Company Abnova Corporation
Item Mouse Anti-SF3B2 Polyclonal Antibody, Unconjugated
Price 
Description Mouse polyclonal antibody raised against a partial recombinant SF3B2.
Immunogen: SF3B2 (NP_006833, 592 a.a. ~ 646 a.a) partial recombinant protein with GST tag.
Accession Number: NM_006842
Protein Sequence: YEGKEFETRLKEKKPGDLSDELRISLGMPVGPNAHKVPPPWLIAMQRYGPPPSY*
Info Abnova CorporationAbnova Corporation
Abnova Corporation (HQ)
9th Fl., No. 108, Jhouzih St.
Neihu District, Taipei
114 Taiwan R.O.C.
Tel: +886-2-8751-1888
Fax: +886-2-8751-1166

Abnova GmbH
Boxbergring 107
69126 Heidelberg
Germany
Tel: +49 6221 3632226
Fax: +49 6221 825878

Customer Service: +886-2-8751-1888
Fax Number: +886-2-8751-1166
Web Site: http://www.abnova.com.tw
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Mouse Anti-Amodiaquine Monoclonal Antibody, Unconjugated, Clone 6D10 from AntibodyShop A/S
2. Mouse Anti-Protein S Monoclonal Antibody, Unconjugated, Clone HYB 232-02 from Abcam
3. Mouse Anti-Mouse Glutathione S-transferase M1 (GSTM1) Monoclonal Antibody, Unconjugated from Lifespan Biosciences
4. Mouse Anti-Human S-100 alpha/beta chain Monoclonal Antibody, Unconjugated, Clone 8B10 from Santa Cruz Biotechnology, Inc.
5. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Testis from OriGene Technologies
6. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Brain (adult) from OriGene Technologies
7. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (12.5 - day) from OriGene Technologies
8. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (19 - day) from OriGene Technologies
9. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Thymus from OriGene Technologies
10. Mouse Anti-Human Complement factor B Monoclonal Antibody, Unconjugated, Clone 9B6 from AntibodyShop A/S
11. Mouse Anti-Human Choriongonadotropin (hCG) Monoclonal Antibody, Unconjugated, Clone 5F10 from AntibodyShop A/S
EDG-1CT (endothelial cell differentiation gene-1, C terminal)...
Request Info...
... Recognizes Kir2.1 protein. The epitope ... not present in any other known ... is identical in rabbit, bovine, porcine ... homologous in rat and mouse (17/19 ...
Anti-20S proteasome subunits alpha 1, 2, 3, 5, 6 & 7, clone MCP231 Immunogen: Dinitrophenylated proteasomes Molecular Weight: 29 and 32 kDa....
Biology Products:
(Date:8/26/2018)... , ... August 23, 2018 , ... ... has for increased sensitivity and specificity over more commonly used analytical techniques. However, ... the added burden of development and validation of methods that must be undertaken ...
(Date:8/26/2018)... ... August 25, 2018 , ... Maire Mayne, an ... energy treated nutraceutical to reduce inflammation and autoimmune disorders and improve overall immune ... well as inflammation. The following data was reported:,     Over ...
(Date:8/23/2018)... ... August 21, 2018 , ... CRISPR-Cas9 gene editing strategies ... species for the robust functional interrogation of complex biological processes. Gene editing in ... immunotherapies, the study of the autoimmunity, the understanding of host-pathogen dynamics that drive ...
Breaking Biology News(10 mins):
(Date:8/31/2018)... ... August 29, 2018 , ... A recent expedition led by ... the Institute of Industrial Science, the University of Tokyo, demonstrated how the use ... and study of hard to reach deep sea ecosystems, like intermittently active methane ...
(Date:8/29/2018)... CARMEL, Ind. (PRWEB) , ... August 28, 2018 ... ... company selling nano-technology enhanced spinal implants, announced today the successful completion of a ... 1st Source Capital Corporation, Purdue’s Foundry Investment Fund, Commenda Capital, and Ellipsis Ventures. ...
(Date:8/29/2018)... N.Y. (PRWEB) , ... August 28, 2018 , ... ... leading online retailer of contact lenses, has been ranked in 1138th place on ... growing private companies. , The list represents the most successful companies within ...
(Date:8/29/2018)... ... 28, 2018 , ... LabRoots , the leading provider of interactive virtual ... announce the launch of a new gamification feature, allowing users to earn points by ... LabRoots most popular shirts. , Throughout each month, LabRoots users will earn points by ...
Breaking Biology Technology: