Navigation Links
Mouse Anti-SF3B2 Polyclonal Antibody, Unconjugated from Abnova Corporation

ProductsMouse Anti-SF3B2 Polyclonal Antibody, Unconjugated from Abnova Corporation
Company Abnova Corporation
Item Mouse Anti-SF3B2 Polyclonal Antibody, Unconjugated
Price 
Description Mouse polyclonal antibody raised against a partial recombinant SF3B2.
Immunogen: SF3B2 (NP_006833, 592 a.a. ~ 646 a.a) partial recombinant protein with GST tag.
Accession Number: NM_006842
Protein Sequence: YEGKEFETRLKEKKPGDLSDELRISLGMPVGPNAHKVPPPWLIAMQRYGPPPSY*
Info Abnova CorporationAbnova Corporation
Abnova Corporation (HQ)
9th Fl., No. 108, Jhouzih St.
Neihu District, Taipei
114 Taiwan R.O.C.
Tel: +886-2-8751-1888
Fax: +886-2-8751-1166

Abnova GmbH
Boxbergring 107
69126 Heidelberg
Germany
Tel: +49 6221 3632226
Fax: +49 6221 825878

Customer Service: +886-2-8751-1888
Fax Number: +886-2-8751-1166
Web Site: http://www.abnova.com.tw
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Mouse Anti-Amodiaquine Monoclonal Antibody, Unconjugated, Clone 6D10 from AntibodyShop A/S
2. Mouse Anti-Protein S Monoclonal Antibody, Unconjugated, Clone HYB 232-02 from Abcam
3. Mouse Anti-Mouse Glutathione S-transferase M1 (GSTM1) Monoclonal Antibody, Unconjugated from Lifespan Biosciences
4. Mouse Anti-Human S-100 alpha/beta chain Monoclonal Antibody, Unconjugated, Clone 8B10 from Santa Cruz Biotechnology, Inc.
5. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Testis from OriGene Technologies
6. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Brain (adult) from OriGene Technologies
7. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (12.5 - day) from OriGene Technologies
8. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (19 - day) from OriGene Technologies
9. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Thymus from OriGene Technologies
10. Mouse Anti-Human Complement factor B Monoclonal Antibody, Unconjugated, Clone 9B6 from AntibodyShop A/S
11. Mouse Anti-Human Choriongonadotropin (hCG) Monoclonal Antibody, Unconjugated, Clone 5F10 from AntibodyShop A/S
...
Mouse monoclonal antibody to UGT2B10 - UDP glucuronosyltransferase 2 family, polypeptide B10...
Mouse polyclonal antibody raised against a partial recombinant LASS3. NCBI Entrez Gene ID = 204219...
... SM-2 adsorbents are macroporous polystyrene beads for ... surface area for adsorbing organics of molecular ... The beads are useful for the adsorption ... for example, the removal of detergents such ...
Biology Products:
(Date:6/15/2016)... , June 15, 2016 ... report titled "Gesture Recognition Market by Application Market - Global Industry ... - 2024". According to the report, the  global gesture ... in 2015 and is estimated to grow at ... billion by 2024.  Increasing application of ...
(Date:6/7/2016)... , June 7, 2016  Syngrafii Inc. ... a business relationship that includes integrating Syngrafii,s patented ... branch project. This collaboration will result in greater ... the credit union, while maintaining existing document workflow ... http://photos.prnewswire.com/prnh/20160606/375871LOGO ...
(Date:6/2/2016)... NEW YORK , June 2, 2016   The ... (Weather), is announcing Watson Ads, an industry-first capability in which ... advertising, by being able to ask questions via voice or ... Marketers have long ... with the consumer, that can be personal, relevant and valuable; ...
Breaking Biology News(10 mins):
(Date:12/5/2016)... , December 5, 2016 ... Expansion Market, by Products (Consumable, Instruments, Automated Cell ... Medicine and Stem Cell Research, Cancer, and Cell-Based ... Cell Banks) - Global Revenue, Trends, Growth, Share, ... Market Research, the global cell expansion market is ...
(Date:12/5/2016)... 2016 /PRNewswire/ - Resverlogix Corp. ("Resverlogix" or the ... and Safety Monitoring Board (DSMB) for the Company,s ... (CVD) patients has completed a second planned safety ... as planned without any modifications. The DSMB reviewed ... or efficacy concerns were identified. The DSMB will ...
(Date:12/5/2016)... LAKE, N.J. , Dec. 5, 2016 /PRNewswire/ ... Phase 3 open-label two-year study of rufinamide, which ... the American Epilepsy Society (AES) held from December ... Analysis of final two-year safety, tolerability and cognitive ... with rufinamide experienced similar safety and tolerability profiles, ...
(Date:12/5/2016)... , December 5, 2016 ... worldwide, with almost $108 billion of revenue and some ... billion were spent on global biopharmaceuticals, and this figure ... morning, Stock-Callers.com has lined up these four equities for ... ACADIA Pharmaceuticals Inc. (NASDAQ: ACAD ), Acorda ...
Breaking Biology Technology: