Navigation Links
Mouse Anti-SF3B2 Polyclonal Antibody, Unconjugated from Abnova Corporation

ProductsMouse Anti-SF3B2 Polyclonal Antibody, Unconjugated from Abnova Corporation
Company Abnova Corporation
Item Mouse Anti-SF3B2 Polyclonal Antibody, Unconjugated
Price 
Description Mouse polyclonal antibody raised against a partial recombinant SF3B2.
Immunogen: SF3B2 (NP_006833, 592 a.a. ~ 646 a.a) partial recombinant protein with GST tag.
Accession Number: NM_006842
Protein Sequence: YEGKEFETRLKEKKPGDLSDELRISLGMPVGPNAHKVPPPWLIAMQRYGPPPSY*
Info Abnova CorporationAbnova Corporation
Abnova Corporation (HQ)
9th Fl., No. 108, Jhouzih St.
Neihu District, Taipei
114 Taiwan R.O.C.
Tel: +886-2-8751-1888
Fax: +886-2-8751-1166

Abnova GmbH
Boxbergring 107
69126 Heidelberg
Germany
Tel: +49 6221 3632226
Fax: +49 6221 825878

Customer Service: +886-2-8751-1888
Fax Number: +886-2-8751-1166
Web Site: http://www.abnova.com.tw
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Mouse Anti-Amodiaquine Monoclonal Antibody, Unconjugated, Clone 6D10 from AntibodyShop A/S
2. Mouse Anti-Protein S Monoclonal Antibody, Unconjugated, Clone HYB 232-02 from Abcam
3. Mouse Anti-Mouse Glutathione S-transferase M1 (GSTM1) Monoclonal Antibody, Unconjugated from Lifespan Biosciences
4. Mouse Anti-Human S-100 alpha/beta chain Monoclonal Antibody, Unconjugated, Clone 8B10 from Santa Cruz Biotechnology, Inc.
5. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Testis from OriGene Technologies
6. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Brain (adult) from OriGene Technologies
7. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (12.5 - day) from OriGene Technologies
8. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (19 - day) from OriGene Technologies
9. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Thymus from OriGene Technologies
10. Mouse Anti-Human Complement factor B Monoclonal Antibody, Unconjugated, Clone 9B6 from AntibodyShop A/S
11. Mouse Anti-Human Choriongonadotropin (hCG) Monoclonal Antibody, Unconjugated, Clone 5F10 from AntibodyShop A/S
... The new Vivaspin 2 bridges the ... ml centrifugal concentrators. This device combines the ... low internal surface and membrane area for ... ,Available with a choice of PES, Cellulose ...
... Recognizes VAMP-2 (Vesicle-Associated Membrane Protein ... does not share homology with ... It is expected that ... with human, Macaca multata and ...
... Monoamine Transporter 2 (VMAT2). An antibody made ... major band at ~55 kDa in postnuclear ... not in wild type cells (2). Some ... weight, were also detected and remain unaffected ...
Immunogen for A300-655A was a phosphorylated synthetic peptide, which represented a portion of human RNA Polymerase II (GeneID 5430) around serine 5 of the C-terminal repeat YSPTSPS....
Biology Products:
(Date:1/22/2015)... Jan. 22, 2015 Research and Markets ... the "Global Wearable Technologies Market and Applications, ... Trends and Forecast 2014-2020" report to their ... smart devices that can be worn on the ...
(Date:1/22/2015)... Jan. 22, 2015 Infinisource has launched its new NXG ... model. The G2 sets a higher standard for collecting attendance ... management solution. With plug-and-play installation, touch screen interface and seamless ... a robust time collection solution for the small to mid-size ...
(Date:12/22/2014)... (NASDAQ: NXTD and NXTDW) ("NXT-ID" or the ... commerce market, announces it has retained famous pickpocket, entertainer and ... CES debut of the Wocket™ biometric smart wallet.  ... booth January 6th and 7 th , 2015, demonstrating some ...
Breaking Biology News(10 mins):Global Wearable Technologies Market and Applications, Opportunities, Industry Analysis, Segmentation, Size, Growth, Share, Overview, Trends and Forecast 2014-2020 2Infinisource's NXG series sets new time clock standard 2NXT-ID Hires Master Pickpocket and Security Consultant Apollo Robbins for Wocket Smart Wallet CES 2015 Debut 2NXT-ID Hires Master Pickpocket and Security Consultant Apollo Robbins for Wocket Smart Wallet CES 2015 Debut 3NXT-ID Hires Master Pickpocket and Security Consultant Apollo Robbins for Wocket Smart Wallet CES 2015 Debut 4
... information can go a long way when it comes to ... led by scientist John Orrock of the University of Wisconsin-Madison ... on the Channel Islands off the southern coast of California. ... by rodents--called Sin Nombre virus. Results of the study ...
... Vobile, a leading provider of video content identification ... television company, announced today that it has begun ... through upgrades to its video fingerprinting system—the biggest ... management platform, the first to be developed by ...
... family members gather at a picnic in your backyard, there may ... barbecue. When flies visit your party, be glad they don,t ... And those are just the ones we know about. An ... who have recently researched the fly family tree -- one of ...
Cached Biology News:Study of deer mice on California's Channel Islands provides new information on hantavirus 2Study of deer mice on California's Channel Islands provides new information on hantavirus 3Youku Upgrades Fingerprinting System for Tougher Copyright Protection Measures 2Youku Upgrades Fingerprinting System for Tougher Copyright Protection Measures 3Too many relatives ruining your picnic? Be glad the flies don't invite their cousins 2
(Date:1/22/2015)... Rootstown, OH (PRWEB) January 22, 2015 Crystal ... announced today that it has received AOAC-PTM Certifications for the ... O111, O121, and O145; collectively referred to as STEC or ... at 1 colony forming unit (cfu) per 325 g of ...
(Date:1/22/2015)... 22, 2015 zFlo Motion , a ... announce an exciting product from a new partner. STT-Systems ... over the past 15 years, with offerings in the optical-motion ... 3D IMU system (inertial measurement unit), iSen, is opening eyes ...
(Date:1/22/2015)... DE (PRWEB) January 22, 2015 Controlled ... Pistoia Alliance, which helps companies check the legal requirements ... to expand to China. , As their international ... are globally adopting software solutions built as a result ...
(Date:1/22/2015)... 22, 2015 Diagenode, Inc., a ... the Bioruptor® and complete solutions for epigenetics research, ... immunoprecipitation, alleviating the need for manual processing. The ... for ChIP of histones or transcription factors and ...
Breaking Biology Technology:Crystal Diagnostics Awarded AOAC-PTM Accreditation for the Rapid Detection of “Big 6” E.coli Food Pathogens 23D Motion Capture Just Got Easy 2Global Compliance Service for Controlled Substances to Expand to China 2Diagenode Launches Unique Semi-Automated Solution for Chromatin Immunoprecipitation 2