Navigation Links
Mouse Anti-SF3B2 Polyclonal Antibody, Unconjugated from Abnova Corporation

ProductsMouse Anti-SF3B2 Polyclonal Antibody, Unconjugated from Abnova Corporation
Company Abnova Corporation
Item Mouse Anti-SF3B2 Polyclonal Antibody, Unconjugated
Price 
Description Mouse polyclonal antibody raised against a partial recombinant SF3B2.
Immunogen: SF3B2 (NP_006833, 592 a.a. ~ 646 a.a) partial recombinant protein with GST tag.
Accession Number: NM_006842
Protein Sequence: YEGKEFETRLKEKKPGDLSDELRISLGMPVGPNAHKVPPPWLIAMQRYGPPPSY*
Info Abnova CorporationAbnova Corporation
Abnova Corporation (HQ)
9th Fl., No. 108, Jhouzih St.
Neihu District, Taipei
114 Taiwan R.O.C.
Tel: +886-2-8751-1888
Fax: +886-2-8751-1166

Abnova GmbH
Boxbergring 107
69126 Heidelberg
Germany
Tel: +49 6221 3632226
Fax: +49 6221 825878

Customer Service: +886-2-8751-1888
Fax Number: +886-2-8751-1166
Web Site: http://www.abnova.com.tw
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Mouse Anti-Amodiaquine Monoclonal Antibody, Unconjugated, Clone 6D10 from AntibodyShop A/S
2. Mouse Anti-Protein S Monoclonal Antibody, Unconjugated, Clone HYB 232-02 from Abcam
3. Mouse Anti-Mouse Glutathione S-transferase M1 (GSTM1) Monoclonal Antibody, Unconjugated from Lifespan Biosciences
4. Mouse Anti-Human S-100 alpha/beta chain Monoclonal Antibody, Unconjugated, Clone 8B10 from Santa Cruz Biotechnology, Inc.
5. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Testis from OriGene Technologies
6. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Brain (adult) from OriGene Technologies
7. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (12.5 - day) from OriGene Technologies
8. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (19 - day) from OriGene Technologies
9. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Thymus from OriGene Technologies
10. Mouse Anti-Human Complement factor B Monoclonal Antibody, Unconjugated, Clone 9B6 from AntibodyShop A/S
11. Mouse Anti-Human Choriongonadotropin (hCG) Monoclonal Antibody, Unconjugated, Clone 5F10 from AntibodyShop A/S
... the only Gradient thermal cycler which enables you ... a screen. ,Wide linear gradient - The ... an amazing range of,30C. Protocols can be optimised ... The Touchgene Gradient incorporates a large, 115 x ...
... TC-3000 is one of the smallest thermal cyclers ... choice of either the 0.5ml (20 samples) or ... , Fast heating and cooling rate of ... and high performance Fast track programming with ...
Preparation Note: by a modification of the procedure of C.W. Hancher et al., Biotechnol. Bioeng. 11, 1055 (1969) Assay: ~ 20 A 260 /mg Solubility: water 10 mg/mL, clear, light-yellow Suitab tst...
... is based on a new flow-through technology, automates ... situ hybridization of tissues on microscope slide formats. ... of gene expression, in situ hybridization (ISH) localizes ... be used to validate and confirm results obtained ...
Biology Products:
(Date:8/23/2017)... , Aug. 23, 2017  The general public,s help is being ... microbiome—the bacteria that live in and on the human body –and are ... The Microbiome ... the human microbiome, starting with the gut. The project's goal is to ... Photo credit: IBM ...
(Date:6/30/2017)... Va. , June 30, 2017 ... leading developer and supplier of face and eye ... ATA Featured Product provider program. ... an innovative way to monitor a driver,s attentiveness ... greatly from being able to detect fatigue and ...
(Date:5/23/2017)... 2017  Hunova, the first robotic gym for the rehabilitation and functional ... in Genoa, Italy . The first 30 robots will ... USA . The technology was developed and patented at ... IIT spin-off Movendo Technology thanks to a 10 million euro investment from ... click: ...
Breaking Biology News(10 mins):
(Date:10/11/2017)... ... October 11, 2017 , ... ... granted orphan drug designation to SBT-100, its novel anti-STAT3 (Signal Transducer and Activator ... osteosarcoma. SBT-100 is able to cross the cell membrane and bind intracellular STAT3 ...
(Date:10/10/2017)... -- International research firm Parks Associates announced today that ... TMA 2017 Annual Meeting , October 11 in Scottsdale, Arizona ... market and how smart safety and security products impact the competitive landscape. ... Parks Associates: Smart Home Devices: Main Purchase ... "The residential security market has experienced continued growth, ...
(Date:10/9/2017)... Jupiter, FL (PRWEB) , ... October 09, 2017 , ... ... episode, scheduled to broadcast first quarter 2018. American Farmer airs Tuesdays at 8:30aET on ... Agriculture industry is faced with the challenge of how to continue to feed a ...
(Date:10/7/2017)... Seattle, WA (PRWEB) , ... ... ... the industry leader in Hi-C-based genomic technologies, launched its ProxiMeta™ Hi-C metagenome ... the ProxiMeta Hi-C kit and accompanying cloud-based bioinformatics software to perform Hi-C ...
Breaking Biology Technology: