Navigation Links
Mouse Anti-SF3B2 Polyclonal Antibody, Unconjugated from Abnova Corporation

ProductsMouse Anti-SF3B2 Polyclonal Antibody, Unconjugated from Abnova Corporation
Company Abnova Corporation
Item Mouse Anti-SF3B2 Polyclonal Antibody, Unconjugated
Price 
Description Mouse polyclonal antibody raised against a partial recombinant SF3B2.
Immunogen: SF3B2 (NP_006833, 592 a.a. ~ 646 a.a) partial recombinant protein with GST tag.
Accession Number: NM_006842
Protein Sequence: YEGKEFETRLKEKKPGDLSDELRISLGMPVGPNAHKVPPPWLIAMQRYGPPPSY*
Info Abnova CorporationAbnova Corporation
Abnova Corporation (HQ)
9th Fl., No. 108, Jhouzih St.
Neihu District, Taipei
114 Taiwan R.O.C.
Tel: +886-2-8751-1888
Fax: +886-2-8751-1166

Abnova GmbH
Boxbergring 107
69126 Heidelberg
Germany
Tel: +49 6221 3632226
Fax: +49 6221 825878

Customer Service: +886-2-8751-1888
Fax Number: +886-2-8751-1166
Web Site: http://www.abnova.com.tw
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Mouse Anti-Amodiaquine Monoclonal Antibody, Unconjugated, Clone 6D10 from AntibodyShop A/S
2. Mouse Anti-Protein S Monoclonal Antibody, Unconjugated, Clone HYB 232-02 from Abcam
3. Mouse Anti-Mouse Glutathione S-transferase M1 (GSTM1) Monoclonal Antibody, Unconjugated from Lifespan Biosciences
4. Mouse Anti-Human S-100 alpha/beta chain Monoclonal Antibody, Unconjugated, Clone 8B10 from Santa Cruz Biotechnology, Inc.
5. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Testis from OriGene Technologies
6. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Brain (adult) from OriGene Technologies
7. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (12.5 - day) from OriGene Technologies
8. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (19 - day) from OriGene Technologies
9. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Thymus from OriGene Technologies
10. Mouse Anti-Human Complement factor B Monoclonal Antibody, Unconjugated, Clone 9B6 from AntibodyShop A/S
11. Mouse Anti-Human Choriongonadotropin (hCG) Monoclonal Antibody, Unconjugated, Clone 5F10 from AntibodyShop A/S
Goat anti-PITPN Class: Antibody Product Group: Miscellaneous Antibody...
Goat polyclonal to Nebraska Calf Diarrhea Virus (FITC) ( Abpromise for all tested applications). Antigen: Bovine (Nebraska Calf Diarrhea Virus)....
Sheep polyclonal to Trenbolone ( Abpromise for all tested applications). Antigen: Chemical / Small Molecule: 17 alpha Trenbolone(3)-BTG....
Phospho- (Ser/Thr) PDK1 Docking Motif (18A2) Mouse mAb...
Biology Products:
(Date:3/9/2019)... ... ... Murrieta Genomics , the genomic sequencing business incubator, is pleased to ... California Riverside’s EPIC SBDC focused on research funding by U.S. Small Business Administration. The ... 2019. The location is the Highlander Union Building, Room 302 South on the University ...
(Date:3/9/2019)... ... March 08, 2019 , ... Ace ... product, Well-Mints™ resveratrol + ribose hard candy lozenges ( http://www.well-mints.com ). , Well-Mints™ ... naturally flavored hard candy base dusted with powdered sugar. , Well-Mints'™ patented technology ...
(Date:3/1/2019)... DIEGO (PRWEB) , ... February 28, 2019 , ... Teresa ... Rechts der Isar of the Technical University Munich, has been awarded an xCELLigence Research ... for an improved oncolytic virus platform. , Oncolytic viruses represent an exciting ...
Breaking Biology News(10 mins):
(Date:3/12/2019)... LITTLETON, Colo. (PRWEB) , ... March 11, 2019 ... ... now the first hospital system in Colorado, and among the first in the ... satisfaction scores around lab draws, IV placement and overall degree to which staff ...
(Date:3/9/2019)... ... March 08, 2019 , ... ... education planning, announced the release of their Best Online Master's in Biotechnology ... based on curriculum quality, program flexibility, affordability, and graduate outcomes. , In ...
(Date:2/27/2019)... , ... February 26, 2019 , ... ... custom industrial automation and IT solutions with 140 employees on both the east ... professional engineer’s license in the State of New Hampshire. Sandmaier, a senior project ...
(Date:2/19/2019)... ... February 19, 2019 , ... VetStem Biopharma ... manufacturing experience. In October 2018, VetStem authorized the formation of Personalized Stem Cells, ... its stem cell patents, data, and FDA filings to launch into human stem cell ...
Breaking Biology Technology: