Navigation Links
Mouse Anti-SF3B2 Polyclonal Antibody, Unconjugated from Abnova Corporation

ProductsMouse Anti-SF3B2 Polyclonal Antibody, Unconjugated from Abnova Corporation
Company Abnova Corporation
Item Mouse Anti-SF3B2 Polyclonal Antibody, Unconjugated
Price 
Description Mouse polyclonal antibody raised against a partial recombinant SF3B2.
Immunogen: SF3B2 (NP_006833, 592 a.a. ~ 646 a.a) partial recombinant protein with GST tag.
Accession Number: NM_006842
Protein Sequence: YEGKEFETRLKEKKPGDLSDELRISLGMPVGPNAHKVPPPWLIAMQRYGPPPSY*
Info Abnova CorporationAbnova Corporation
Abnova Corporation (HQ)
9th Fl., No. 108, Jhouzih St.
Neihu District, Taipei
114 Taiwan R.O.C.
Tel: +886-2-8751-1888
Fax: +886-2-8751-1166

Abnova GmbH
Boxbergring 107
69126 Heidelberg
Germany
Tel: +49 6221 3632226
Fax: +49 6221 825878

Customer Service: +886-2-8751-1888
Fax Number: +886-2-8751-1166
Web Site: http://www.abnova.com.tw
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Mouse Anti-Amodiaquine Monoclonal Antibody, Unconjugated, Clone 6D10 from AntibodyShop A/S
2. Mouse Anti-Protein S Monoclonal Antibody, Unconjugated, Clone HYB 232-02 from Abcam
3. Mouse Anti-Mouse Glutathione S-transferase M1 (GSTM1) Monoclonal Antibody, Unconjugated from Lifespan Biosciences
4. Mouse Anti-Human S-100 alpha/beta chain Monoclonal Antibody, Unconjugated, Clone 8B10 from Santa Cruz Biotechnology, Inc.
5. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Testis from OriGene Technologies
6. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Brain (adult) from OriGene Technologies
7. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (12.5 - day) from OriGene Technologies
8. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (19 - day) from OriGene Technologies
9. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Thymus from OriGene Technologies
10. Mouse Anti-Human Complement factor B Monoclonal Antibody, Unconjugated, Clone 9B6 from AntibodyShop A/S
11. Mouse Anti-Human Choriongonadotropin (hCG) Monoclonal Antibody, Unconjugated, Clone 5F10 from AntibodyShop A/S
Anti-Mouse MIP-1g, Biotin (Polyclonal) (rabbit IgG)...
Request Info...
R26.4C...
... 17 3/4" x 8 15/16" ... 0 - 100 hoursControl: Programmable 30 - ... user programmable protocols 3 operating modes (Denaturation/Hybridization, ... ramp-up from 37 - 95C and cooling ...
Biology Products:
(Date:1/6/2017)... -- Delta ID Inc., a leader in consumer-grade iris scanning ... CES® 2017. Delta ID has collaborated with Gentex Corporation ... of iris scanning as a secure, reliable and convenient ... car, and as a way to elevate the security ... ID and Gentex will demonstrate (booth #7326 LVCC) a ...
(Date:12/22/2016)... YORK , December 22, 2016 ... provider of secure solutions for the e-Government, Public Safety, HealthCare, and ... subsidiary of SuperCom, has been selected to implement and deploy a ... in Northern California , further expanding its presence ... ...
(Date:12/16/2016)... 16, 2016 Research and Markets has announced ... Global Forecast to 2021" report to their offering. ... The biometric vehicle access ... a CAGR of 14.06% from 2016 to 2021. The market is ... to reach 854.8 Million by 2021. The growth of the biometric ...
Breaking Biology News(10 mins):
(Date:1/17/2017)... -- Research and Markets has announced the addition ... Markets and Companies" to their offering. ... The number of ... past few years. More than 1,000 companies have been identified ... these are profiled in the report along with tabulation of ...
(Date:1/17/2017)... ... January 17, 2017 , ... ... Safety Technology Consortium™ (SafeTEC™), $3 million in investment towards 15+ TEC Validation Projects™. ... and assays, and their applicability in drug safety assessment, for the industry as ...
(Date:1/16/2017)... ... January 16, 2017 , ... Appellate Court ... decision on the appeal filed by India-based Dishman Pharmaceutical & Chemical Ltd. company ... DPCL and one of its Dishman Group’s 100% wholly owned New Jersey-based subsidiary ...
(Date:1/14/2017)... Va. , Jan. 13, 2017  The Alliance ... statement in response to FDA final guidance ... for its continued leadership in emphasizing the importance of ... are keenly aware of the benefits biosimilars will bring ...   Yet the portion of the Guidance ...
Breaking Biology Technology: