Navigation Links
Mouse Anti-SF3B2 Polyclonal Antibody, Unconjugated from Abnova Corporation

ProductsMouse Anti-SF3B2 Polyclonal Antibody, Unconjugated from Abnova Corporation
Company Abnova Corporation
Item Mouse Anti-SF3B2 Polyclonal Antibody, Unconjugated
Price 
Description Mouse polyclonal antibody raised against a partial recombinant SF3B2.
Immunogen: SF3B2 (NP_006833, 592 a.a. ~ 646 a.a) partial recombinant protein with GST tag.
Accession Number: NM_006842
Protein Sequence: YEGKEFETRLKEKKPGDLSDELRISLGMPVGPNAHKVPPPWLIAMQRYGPPPSY*
Info Abnova CorporationAbnova Corporation
Abnova Corporation (HQ)
9th Fl., No. 108, Jhouzih St.
Neihu District, Taipei
114 Taiwan R.O.C.
Tel: +886-2-8751-1888
Fax: +886-2-8751-1166

Abnova GmbH
Boxbergring 107
69126 Heidelberg
Germany
Tel: +49 6221 3632226
Fax: +49 6221 825878

Customer Service: +886-2-8751-1888
Fax Number: +886-2-8751-1166
Web Site: http://www.abnova.com.tw
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Mouse Anti-Amodiaquine Monoclonal Antibody, Unconjugated, Clone 6D10 from AntibodyShop A/S
2. Mouse Anti-Protein S Monoclonal Antibody, Unconjugated, Clone HYB 232-02 from Abcam
3. Mouse Anti-Mouse Glutathione S-transferase M1 (GSTM1) Monoclonal Antibody, Unconjugated from Lifespan Biosciences
4. Mouse Anti-Human S-100 alpha/beta chain Monoclonal Antibody, Unconjugated, Clone 8B10 from Santa Cruz Biotechnology, Inc.
5. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Testis from OriGene Technologies
6. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Brain (adult) from OriGene Technologies
7. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (12.5 - day) from OriGene Technologies
8. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (19 - day) from OriGene Technologies
9. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Thymus from OriGene Technologies
10. Mouse Anti-Human Complement factor B Monoclonal Antibody, Unconjugated, Clone 9B6 from AntibodyShop A/S
11. Mouse Anti-Human Choriongonadotropin (hCG) Monoclonal Antibody, Unconjugated, Clone 5F10 from AntibodyShop A/S
... is a nucleoside antibiotic ... is a potent translational ... and eukaryotic cells. Resistance ... by the products of ...
... (Aph-1aL,S Loop 92-115), O2F1 Affinity Purified ... multiprotein complex consisting of presenilin, nicastrin, ... are necessary for full proteolytic activity. ... of a number of integral membrane ...
... Biochem/physiol Actions: Glutathione-S-transferases (GSTs) are a ... of many xenobiotics in mammals. The ... the thiol group of the glutathione to ... the mutagenic, carcinogenic, and toxic effects of ...
15(S)-HEDE is produced from 11Z,14Z-eicosadienoic acid by 15-LO. 15(S)-HEDE is an inhibitor of RBL-1 cell 5-LO with an IC50 value of 26 µM....
Biology Products:
(Date:2/4/2016)... , Feb. 4, 2016 The ... apparently one of the most popular hubs of ... MetaHIT and other huge studies of human microbiota, ... past few years, the microbiome space has literally ... biomedical research. This report focuses on biomedical ...
(Date:2/2/2016)... , Feb. 2, 2016  BioMEMS ... are primarily focused on medical screening and ... point-of-care parameters. Wearable devices that facilitate and ... freedom of movement are being bolstered through ... human biomedical signal acquisition coupled with wireless ...
(Date:2/2/2016)... , Feb. 2, 2016  Based on its ... & Sullivan recognizes US-based Intelligent Retinal Imaging Systems ... Sullivan Award for New Product Innovation. IRIS, a ... North America , is poised to ... growing diabetic retinopathy market. The IRIS technology presents ...
Breaking Biology News(10 mins):
(Date:2/10/2016)... (PRWEB) , ... February 10, ... ... REGN) today announced that it has joined the Human Vaccines Project, a ... infectious diseases and cancer. , The Human Vaccines Project brings together ...
(Date:2/10/2016)... , ... February 10, 2016 , ... ... three states, announced today the promotion of two long-standing principal investigators (PI) to ... Family Medicine, Clinical Research and Development. , Dr. Laurence Chu, a Benchmark Research ...
(Date:2/10/2016)... ... February 10, 2016 , ... PatientCrossroads ... on the secure online PatientCrossroads platform, has exceeded both its one-year and overall ... the PROMPT study, which seeks to advance understanding of the hereditary risks for ...
(Date:2/10/2016)... ... February 09, 2016 , ... Creation Technologies, leading ... the Highest Overall Customer Rating Award from Circuits Assembly , today announced its ... the USA, Canada, Mexico and China. , The EMS provider, known in the ...
Breaking Biology Technology: