Navigation Links
Mouse Anti-SF3B2 Polyclonal Antibody, Unconjugated from Abnova Corporation

ProductsMouse Anti-SF3B2 Polyclonal Antibody, Unconjugated from Abnova Corporation
Company Abnova Corporation
Item Mouse Anti-SF3B2 Polyclonal Antibody, Unconjugated
Price 
Description Mouse polyclonal antibody raised against a partial recombinant SF3B2.
Immunogen: SF3B2 (NP_006833, 592 a.a. ~ 646 a.a) partial recombinant protein with GST tag.
Accession Number: NM_006842
Protein Sequence: YEGKEFETRLKEKKPGDLSDELRISLGMPVGPNAHKVPPPWLIAMQRYGPPPSY*
Info Abnova CorporationAbnova Corporation
Abnova Corporation (HQ)
9th Fl., No. 108, Jhouzih St.
Neihu District, Taipei
114 Taiwan R.O.C.
Tel: +886-2-8751-1888
Fax: +886-2-8751-1166

Abnova GmbH
Boxbergring 107
69126 Heidelberg
Germany
Tel: +49 6221 3632226
Fax: +49 6221 825878

Customer Service: +886-2-8751-1888
Fax Number: +886-2-8751-1166
Web Site: http://www.abnova.com.tw
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Mouse Anti-Amodiaquine Monoclonal Antibody, Unconjugated, Clone 6D10 from AntibodyShop A/S
2. Mouse Anti-Protein S Monoclonal Antibody, Unconjugated, Clone HYB 232-02 from Abcam
3. Mouse Anti-Mouse Glutathione S-transferase M1 (GSTM1) Monoclonal Antibody, Unconjugated from Lifespan Biosciences
4. Mouse Anti-Human S-100 alpha/beta chain Monoclonal Antibody, Unconjugated, Clone 8B10 from Santa Cruz Biotechnology, Inc.
5. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Testis from OriGene Technologies
6. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Brain (adult) from OriGene Technologies
7. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (12.5 - day) from OriGene Technologies
8. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (19 - day) from OriGene Technologies
9. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Thymus from OriGene Technologies
10. Mouse Anti-Human Complement factor B Monoclonal Antibody, Unconjugated, Clone 9B6 from AntibodyShop A/S
11. Mouse Anti-Human Choriongonadotropin (hCG) Monoclonal Antibody, Unconjugated, Clone 5F10 from AntibodyShop A/S
ANTI 5-HYDROXYTRYPTOPHAN CONJ....
IMAGEQUANT 300 WKSTN, 1 EA. Category: ImageQuant CCD Imagers....
... For use with T4 Polynucleotide Kinase ... phosphate ends) of nucleic acids. In ... transfers the 5' phosphate group from ... the Gamma-phosphate of ATP to the ...
JTV1 gene...
Biology Products:
(Date:11/20/2018)... ... November 20, 2018 , ... Thanks to its long-standing expertise in ... the ID reader market, as the company now proposes a full range of readers ... Elyctis ID reader range can be used by professionals either in a fixed location ...
(Date:11/16/2018)... ... November 16, 2018 , ... OnlineMasters.com, an industry-leading educational ... Programs for 2019. They have identified the top programs in the nation that ... graduate outcomes. , Leveraging an exclusive data set comprised of interviews and surveys ...
(Date:11/15/2018)... ... 2018 , ... uBiome, the leader in microbial genomics, announces ... Functional Medicine to its Medical Advisory Board. Joining the board of leading scientists ... experience in treating the root causes of disease, conscientiously taking into account nutritional, ...
Breaking Biology News(10 mins):
(Date:11/9/2018)... ... November 08, 2018 , ... IC System, ... machine-learning powered approach to increasing recovery rates by creating a comprehensive contact strategy ... (AIC) product developed by NLP Logix, a Jacksonville, Florida-based AI solutions company, and ...
(Date:11/6/2018)... ... November 06, 2018 , ... ... for clinical trial data collection and management. TrialKit ™, an eClinical platform, ... generation devices can quickly and easily sign in to the app via facial ...
(Date:11/5/2018)... Ill. (PRWEB) , ... November 05, 2018 , ... ... Inc., for access to 2Blades’ Transcription Activator Like (TAL) effector code technology for ... for commercial uses of the technology in plants. Since its discovery in 2009, the ...
(Date:10/31/2018)... ... 30, 2018 , ... Myoscience, Inc. announced today that it ... Memphis, Tennessee. This study enrolled 125 patients and compares the effect of ... after total knee replacement surgery (TKA). , The Myoscience iovera° system is currently ...
Breaking Biology Technology: