Navigation Links
Mouse Anti-SF3B2 Polyclonal Antibody, Unconjugated from Abnova Corporation

ProductsMouse Anti-SF3B2 Polyclonal Antibody, Unconjugated from Abnova Corporation
Company Abnova Corporation
Item Mouse Anti-SF3B2 Polyclonal Antibody, Unconjugated
Price 
Description Mouse polyclonal antibody raised against a partial recombinant SF3B2.
Immunogen: SF3B2 (NP_006833, 592 a.a. ~ 646 a.a) partial recombinant protein with GST tag.
Accession Number: NM_006842
Protein Sequence: YEGKEFETRLKEKKPGDLSDELRISLGMPVGPNAHKVPPPWLIAMQRYGPPPSY*
Info Abnova CorporationAbnova Corporation
Abnova Corporation (HQ)
9th Fl., No. 108, Jhouzih St.
Neihu District, Taipei
114 Taiwan R.O.C.
Tel: +886-2-8751-1888
Fax: +886-2-8751-1166

Abnova GmbH
Boxbergring 107
69126 Heidelberg
Germany
Tel: +49 6221 3632226
Fax: +49 6221 825878

Customer Service: +886-2-8751-1888
Fax Number: +886-2-8751-1166
Web Site: http://www.abnova.com.tw
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Mouse Anti-Amodiaquine Monoclonal Antibody, Unconjugated, Clone 6D10 from AntibodyShop A/S
2. Mouse Anti-Protein S Monoclonal Antibody, Unconjugated, Clone HYB 232-02 from Abcam
3. Mouse Anti-Mouse Glutathione S-transferase M1 (GSTM1) Monoclonal Antibody, Unconjugated from Lifespan Biosciences
4. Mouse Anti-Human S-100 alpha/beta chain Monoclonal Antibody, Unconjugated, Clone 8B10 from Santa Cruz Biotechnology, Inc.
5. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Testis from OriGene Technologies
6. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Brain (adult) from OriGene Technologies
7. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (12.5 - day) from OriGene Technologies
8. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (19 - day) from OriGene Technologies
9. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Thymus from OriGene Technologies
10. Mouse Anti-Human Complement factor B Monoclonal Antibody, Unconjugated, Clone 9B6 from AntibodyShop A/S
11. Mouse Anti-Human Choriongonadotropin (hCG) Monoclonal Antibody, Unconjugated, Clone 5F10 from AntibodyShop A/S
... mini, SSM3 & SSM4, Small space saving design ... , Choice of two models: , - 3D ... , Digital speed control and built-in timer ... ,These compact rockers are ideal where gentle mixing is ...
...
... a partial recombinant MAK. Immunogen: ... partial recombinant protein with GST tag. ... Accession: BC039825 Protein Accession ... 154235, GeneID: 4117 ...
Mouse monoclonal antibody raised against a full length recombinant PPIL2. NCBI Entrez Gene ID = PPIL2...
Biology Products:
(Date:8/6/2015)... , Aug. 6, 2015  Today, U.S. ... visit Crossmatch ™ to learn firsthand how ... protect data. Crossmatch is a world leader in ... and expertise are helping federal agencies and commercial ... security.   "The vast majority of ...
(Date:8/5/2015)... CHICAGO , August 5, 2015 ... Identity & Access Management Market by Software, Services, Vertical (BFSI, ... Chemical/Pharma), & Geography - Global Forecast to 2020", published ... Access Management Market globally into various segments. The global ... in 2014 to $546.2 Million by 2019, at a ...
(Date:8/4/2015)... , Aug. 04, 2015 ... ) has announced the addition of the ... Software, and Service), Sub-Segment (Computer Forensics, Network ... Tool Types, Service, Vertical and Region - ... their offering. By Component (Hardware, ...
Breaking Biology News(10 mins):Rep. Honda to Visit Crossmatch in Redwood City 2Physical Identity and Access Management Market Worth $546.2 Million by 2019 2Physical Identity and Access Management Market Worth $546.2 Million by 2019 3Physical Identity and Access Management Market Worth $546.2 Million by 2019 4Digital Forensics Market - The Market Represents a Compound Annual Growth Rate (CAGR) of 11.3% From 2015 to 2020 2
... One of the smallest parts of the brain is getting ... crucial role in decision making. A University of British ... the lateral habenula, a region of the brain linked to ... be integral in cost-benefit decisions. "These findings clarify the ...
... -- Many owl species have developed specialized plumage to effectively ... to hunt and capture their prey in silence. ... how owls achieve this acoustic stealth will present their findings ... meeting, held Nov. 24 26, in Pittsburgh, Pa. -- ...
... Greenland,s ice sheet is small today? It was smaller ... from 3-5,000 years ago, according to scientists who studied the ice ... Arctic fossil record. "What,s really interesting about this is that ... ago, maybe as late as 4,000 years ago. The oceans, on ...
Cached Biology News:Scientists find brain region that helps you make up your mind 2The secrets of owls' near noiseless wings 2Greenland's shrunken ice sheet: We've been here before 2Greenland's shrunken ice sheet: We've been here before 3
(Date:8/26/2015)... MIAMI , Aug. 26, 2015  The ... at the University of Miami Miller School of ... its clinical trial to test for the first ... was successfully completed.  This FDA approved Phase I/II ... islet transplantation and is an important first step ...
(Date:8/26/2015)... and BEIJING , August 26, 2015 ... Scene with Impressive Acheivements  DiaCardio wins 1 st ... The competition, led in Israel ... featured 21 startups from countries including the US, China ... and Latin America .  Impressive ...
(Date:8/26/2015)... CORAL SPRINGS, Florida , August 26, 2015 ... one of the biggest factors fueling the optimism ... FDA approvals, M&A,s, collaborations and life sciences advancements.  ... and developments are Pressure BioSciences, Inc. (OTCQB: PBIO), ... Inc. (NASDAQ: SRPT ), Raptor Pharmaceutical Corp. ...
(Date:8/25/2015)... 25, 2015   WuXi PharmaTech (Cayman) Inc. (NYSE: ... technology platform company serving the pharmaceutical, biotechnology, and medical ... Hong Kong Exchange Stock Code: 0950), a research-based biopharmaceutical ... with 20 years of operations in China ... signed an agreement whereby WuXi,s Laboratory Testing Division (LTD) ...
Breaking Biology Technology:Diabetes Research Institute Successfully Transplants First Patient In Pilot BioHub Trial 2Diabetes Research Institute Successfully Transplants First Patient In Pilot BioHub Trial 3Diabetes Research Institute Successfully Transplants First Patient In Pilot BioHub Trial 4Israeli Startup Takes First Place at Shengjing Global Innovation Awards 2015 2Israeli Startup Takes First Place at Shengjing Global Innovation Awards 2015 3Israeli Startup Takes First Place at Shengjing Global Innovation Awards 2015 4Israeli Startup Takes First Place at Shengjing Global Innovation Awards 2015 5Israeli Startup Takes First Place at Shengjing Global Innovation Awards 2015 6New Collaborations & Mergers For Research of Molecular Biomarkers in Human Diseases & Clinical Trials for Cancer Therapies Fueling Growth in Multi-Billion Dollar Life Sciences Market 2New Collaborations & Mergers For Research of Molecular Biomarkers in Human Diseases & Clinical Trials for Cancer Therapies Fueling Growth in Multi-Billion Dollar Life Sciences Market 3New Collaborations & Mergers For Research of Molecular Biomarkers in Human Diseases & Clinical Trials for Cancer Therapies Fueling Growth in Multi-Billion Dollar Life Sciences Market 4New Collaborations & Mergers For Research of Molecular Biomarkers in Human Diseases & Clinical Trials for Cancer Therapies Fueling Growth in Multi-Billion Dollar Life Sciences Market 5New Collaborations & Mergers For Research of Molecular Biomarkers in Human Diseases & Clinical Trials for Cancer Therapies Fueling Growth in Multi-Billion Dollar Life Sciences Market 6New Collaborations & Mergers For Research of Molecular Biomarkers in Human Diseases & Clinical Trials for Cancer Therapies Fueling Growth in Multi-Billion Dollar Life Sciences Market 7WuXi PharmaTech to Be Exclusive Supplier of Laboratory Testing Services to Lee's Pharm 2WuXi PharmaTech to Be Exclusive Supplier of Laboratory Testing Services to Lee's Pharm 3