Navigation Links
Mouse Anti-SF3B2 Polyclonal Antibody, Unconjugated from Abnova Corporation

ProductsMouse Anti-SF3B2 Polyclonal Antibody, Unconjugated from Abnova Corporation
Company Abnova Corporation
Item Mouse Anti-SF3B2 Polyclonal Antibody, Unconjugated
Price 
Description Mouse polyclonal antibody raised against a partial recombinant SF3B2.
Immunogen: SF3B2 (NP_006833, 592 a.a. ~ 646 a.a) partial recombinant protein with GST tag.
Accession Number: NM_006842
Protein Sequence: YEGKEFETRLKEKKPGDLSDELRISLGMPVGPNAHKVPPPWLIAMQRYGPPPSY*
Info Abnova CorporationAbnova Corporation
Abnova Corporation (HQ)
9th Fl., No. 108, Jhouzih St.
Neihu District, Taipei
114 Taiwan R.O.C.
Tel: +886-2-8751-1888
Fax: +886-2-8751-1166

Abnova GmbH
Boxbergring 107
69126 Heidelberg
Germany
Tel: +49 6221 3632226
Fax: +49 6221 825878

Customer Service: +886-2-8751-1888
Fax Number: +886-2-8751-1166
Web Site: http://www.abnova.com.tw
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Mouse Anti-Amodiaquine Monoclonal Antibody, Unconjugated, Clone 6D10 from AntibodyShop A/S
2. Mouse Anti-Protein S Monoclonal Antibody, Unconjugated, Clone HYB 232-02 from Abcam
3. Mouse Anti-Mouse Glutathione S-transferase M1 (GSTM1) Monoclonal Antibody, Unconjugated from Lifespan Biosciences
4. Mouse Anti-Human S-100 alpha/beta chain Monoclonal Antibody, Unconjugated, Clone 8B10 from Santa Cruz Biotechnology, Inc.
5. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Testis from OriGene Technologies
6. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Brain (adult) from OriGene Technologies
7. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (12.5 - day) from OriGene Technologies
8. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (19 - day) from OriGene Technologies
9. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Thymus from OriGene Technologies
10. Mouse Anti-Human Complement factor B Monoclonal Antibody, Unconjugated, Clone 9B6 from AntibodyShop A/S
11. Mouse Anti-Human Choriongonadotropin (hCG) Monoclonal Antibody, Unconjugated, Clone 5F10 from AntibodyShop A/S
... IHC Protocol Development ,Antibody Titer and ... Animal or Human Cells and Tissues ... Tissues ,Peroxidase, Alkaline Phosphatase, Immunogold, and ... Microscopy ,Protein Localization in Transgenic Animals ...
... the optimization of immunostaining. ... the primary antibody, selection and ... Alk. Phos., HRP, fluorescence, or ... evaluation by light or fluorescence ...
Request Info...
Request Info...
Biology Products:
(Date:3/11/2016)... http://www.apimages.com ) - --> http://www.apimages.com ) - ... Images ( http://www.apimages.com ) - Germany . ... new refugee identity cards. DERMALOG will be unveiling this device, and ... Hanover next week.   --> Germany ... the new refugee identity cards. DERMALOG will be unveiling this device, ...
(Date:3/9/2016)... -- This BCC Research report provides an overview of ... (RNA Seq) market for the years 2015, 2016 and ... data analysis, and services. Use this report ... such as RNA-Sequencing tools and reagents, RNA-Sequencing data analysis, ... segment and forecast their market growth, future trends and ...
(Date:3/3/2016)...  FlexTech, a SEMI Strategic Association Partner, awarded five ... Development, Leadership in Education, and, in a category new ... year of the FLEXI Awards and the winners ... past years . Judging was done on a ... criteria, by a panel of non-affiliated, independent, industry experts. ...
Breaking Biology News(10 mins):
(Date:4/28/2016)... ... April 28, 2016 , ... As part ... top industry experts, and expanding its LATAM network and logistics capabilities. Enhancements ... to manage their clinical trial projects. , The expansion will provide unmatched clinical ...
(Date:4/27/2016)... ... April 27, 2016 , ... Cambridge Semantics, the leading provider of ... that it has been named to The Silicon Review’s “20 Fastest Growing Big Data ... Cambridge Semantics serves the needs of end users facing some of the most complex ...
(Date:4/27/2016)... ... , ... The Pittcon Organizing Committee is pleased to announce that Charles “Chuck” ... of Committee since 1987. Since then, he has served in a number of key ... for both the program and exposition committees. In his professional career, Dr. Gardner is ...
(Date:4/27/2016)... Columbia , April 27, 2016 ... "NanoStruck") (CSE: NSK) (OTCPink: NSKQB) ( Frankfurt ... Anschluss an ihre Pressemitteilung vom 13. August 2015 ... hat, ihre Finanzen um zusätzliche 200.000.000 Einheiten auf ... Kanadische Dollar zu bringen. Davon wurden 157.900.000 Einheiten ...
Breaking Biology Technology: