Navigation Links
Mouse Anti-SF3B2 Polyclonal Antibody, Unconjugated from Abnova Corporation

ProductsMouse Anti-SF3B2 Polyclonal Antibody, Unconjugated from Abnova Corporation
Company Abnova Corporation
Item Mouse Anti-SF3B2 Polyclonal Antibody, Unconjugated
Price 
Description Mouse polyclonal antibody raised against a partial recombinant SF3B2.
Immunogen: SF3B2 (NP_006833, 592 a.a. ~ 646 a.a) partial recombinant protein with GST tag.
Accession Number: NM_006842
Protein Sequence: YEGKEFETRLKEKKPGDLSDELRISLGMPVGPNAHKVPPPWLIAMQRYGPPPSY*
Info Abnova CorporationAbnova Corporation
Abnova Corporation (HQ)
9th Fl., No. 108, Jhouzih St.
Neihu District, Taipei
114 Taiwan R.O.C.
Tel: +886-2-8751-1888
Fax: +886-2-8751-1166

Abnova GmbH
Boxbergring 107
69126 Heidelberg
Germany
Tel: +49 6221 3632226
Fax: +49 6221 825878

Customer Service: +886-2-8751-1888
Fax Number: +886-2-8751-1166
Web Site: http://www.abnova.com.tw
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Mouse Anti-Amodiaquine Monoclonal Antibody, Unconjugated, Clone 6D10 from AntibodyShop A/S
2. Mouse Anti-Protein S Monoclonal Antibody, Unconjugated, Clone HYB 232-02 from Abcam
3. Mouse Anti-Mouse Glutathione S-transferase M1 (GSTM1) Monoclonal Antibody, Unconjugated from Lifespan Biosciences
4. Mouse Anti-Human S-100 alpha/beta chain Monoclonal Antibody, Unconjugated, Clone 8B10 from Santa Cruz Biotechnology, Inc.
5. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Testis from OriGene Technologies
6. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Brain (adult) from OriGene Technologies
7. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (12.5 - day) from OriGene Technologies
8. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (19 - day) from OriGene Technologies
9. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Thymus from OriGene Technologies
10. Mouse Anti-Human Complement factor B Monoclonal Antibody, Unconjugated, Clone 9B6 from AntibodyShop A/S
11. Mouse Anti-Human Choriongonadotropin (hCG) Monoclonal Antibody, Unconjugated, Clone 5F10 from AntibodyShop A/S
... Racks for Standard 3" Boxes. ... makes and models of upright freezers ... quality stainless steel and can accommodate ... or plastic boxes. Custom shapes ...
Immunogen: Recombinant rabbit tryptophan hydroxylase, isolated as inclusion bodies from E. coli and purified by preparative SDS-PAGE. Storage: -20 C, Avoid Freeze/Thaw Cycles...
Chlorine-36, 3.7 MBq, 100 uCi. 0.1-0.3 HCl.< 111 MBq/g Cl, < 3 mCi/g Cl.Dispensed to order. Please inquire for alternative pack sizes. Category: Radiochemicals &Radiation Safety, Radiochemicals....
Inquire...
Biology Products:
(Date:3/27/2017)... , March 27, 2017  Catholic Health Services ... Management Systems Society (HIMSS) Analytics for achieving Stage ... Model sm . In addition, CHS previously earned ... hospitals using an electronic medical record (EMR). ... high level of EMR usage in an outpatient ...
(Date:3/23/2017)... 23, 2017 The report "Gesture Recognition and Touchless Sensing ... Geography - Global Forecast to 2022", published by MarketsandMarkets, the market is expected ... 29.63% between 2017 and 2022. Continue Reading ... ... ...
(Date:3/22/2017)... NEW YORK , March 21, 2017 /PRNewswire/ ... Customer Marketing Cloud used by retailers such as ... in its platform — Product Recommendations and Replenishment. Using ... to give more personalized product and replenishment recommendations ... purchases, but also on predictions of customer intent ...
Breaking Biology News(10 mins):
(Date:8/18/2017)... ... August 18, 2017 , ... OAI, a leading ... and Microfluidics Industries, announces the new Model 800E front and backside, semi-automatic mask ... production mask aligners. OAI has already received and installed several orders for ...
(Date:8/16/2017)... , ... August 16, 2017 , ... Tunnell Consulting ... in sessions at the ISPE Annual Meeting and Expo , to be held ... Marina. The event’s theme is “Driving innovation to advance patient therapies.” , The ISPE ...
(Date:8/16/2017)... ... August 16, 2017 , ... While art and science are often thought ... than one might think. A Mesh Is Also a Snare, a group exhibition ... Science Center’s Esther Klein Gallery (EKG) on August 17 and run through September 30. ...
(Date:8/16/2017)... Aug. 16, 2017  This year,s edition of the Inc. 5000 features ... sciences workforce solutions, has made the list for the third year in ... nation,s fastest-growing private companies based on a set of quantitative metrics. In ... the fastest-growing companies in the Bay State . ... Inc. 5000 ...
Breaking Biology Technology: