Navigation Links
Mouse Anti-PPP4C Polyclonal Antibody, Unconjugated from Abnova Corporation

ProductsMouse Anti-PPP4C Polyclonal Antibody, Unconjugated from Abnova Corporation
Company Abnova Corporation
Item Mouse Anti-PPP4C Polyclonal Antibody, Unconjugated
Price 
Description Mouse polyclonal antibody raised against a partial recombinant PPP4C.
Immunogen: PPP4C (NP_002711, 218 a.a. ~ 308 a.a) partial recombinant protein with GST tag.
Accession Number: NM_002720
Protein Sequence: GSDVVAQFNAANDIDMICRAHQLVMEGYKWHFNETVLTVWSAPNYCYRCGNVAAILELDEHLQKDFIIFEAAPQETRGIPSKKPVADYFL*
Info Abnova CorporationAbnova Corporation
Abnova Corporation (HQ)
9th Fl., No. 108, Jhouzih St.
Neihu District, Taipei
114 Taiwan R.O.C.
Tel: +886-2-8751-1888
Fax: +886-2-8751-1166

Abnova GmbH
Boxbergring 107
69126 Heidelberg
Germany
Tel: +49 6221 3632226
Fax: +49 6221 825878

Customer Service: +886-2-8751-1888
Fax Number: +886-2-8751-1166
Web Site: http://www.abnova.com.tw
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Mouse Anti-Amodiaquine Monoclonal Antibody, Unconjugated, Clone 6D10 from AntibodyShop A/S
2. Mouse Anti-Protein S Monoclonal Antibody, Unconjugated, Clone HYB 232-02 from Abcam
3. Mouse Anti-Mouse Glutathione S-transferase M1 (GSTM1) Monoclonal Antibody, Unconjugated from Lifespan Biosciences
4. Mouse Anti-Human S-100 alpha/beta chain Monoclonal Antibody, Unconjugated, Clone 8B10 from Santa Cruz Biotechnology, Inc.
5. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Testis from OriGene Technologies
6. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Brain (adult) from OriGene Technologies
7. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (12.5 - day) from OriGene Technologies
8. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (19 - day) from OriGene Technologies
9. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Thymus from OriGene Technologies
10. Mouse Anti-Human Complement factor B Monoclonal Antibody, Unconjugated, Clone 9B6 from AntibodyShop A/S
11. Mouse Anti-Human Choriongonadotropin (hCG) Monoclonal Antibody, Unconjugated, Clone 5F10 from AntibodyShop A/S
... ISO 9001:2000 Certified USDA Research Registered ... SOP's Training AALAS Certified Technicians ... Procedures GLP Documentation Upon Request Focus ... point for all your custom immunology service ...
... XL provides balance data collection and automation that ... integration with Microsoft Excel , Pre-configured library ... , New balances can be added and configured ... from multiple balances into one spreadsheet ...
...
... With increasing age, the autofluorescent ... of many cell types, including neurons. ... complicate the use of fluorescence microscopy ... of its broad excitation and emission ...
Biology Products:
(Date:8/31/2014)... French . ... the prestigious Nature Neuroscience journal by, Sylvain Williams, ... Douglas Mental Health University Institute and McGill University, opens the ... mechanisms controlling memory as well of the role of an ... subiculum. , In 2009, they developed a unique approach ...
(Date:8/29/2014)... University of Texas Medical Branch at Galveston has gone on ... completely protect monkeys against a lethal dose of Ebola virus ... the disease is severe. , Thomas Geisbert, professor of microbiology ... discussing advances in Ebola treatment research. The filoviruses known as ... of pathogens, with fatality rates of up to 90 percent. ...
(Date:8/29/2014)... news release is available in German . ... chemical signals between organisms is considered the oldest form ... interactions between conspecifics, for example, the sexual attraction between ... social responses and to coordinate reproductive behavior in males ... the University of the Algarve in Faro, Portugal, and ...
Breaking Biology News(10 mins):Memory and Alzheimer's: Towards a better comprehension of the dynamic mechanisms 2Leading Ebola researcher at UTMB says there's an effective treatment for Ebola 2Ready for mating at the right time 2Ready for mating at the right time 3
... front-line defense don’t necessarily rest quietly until invading bacteria ... them to action, as previously thought. In a new ... bacteria can barge inside these guard cells and independently ... published online ahead of print in the April issue ...
... Rothberg of the University of Rochester Chemistry Department received a ... recent discovery by Huixiang Li, a research associate in his ... and make sure we're drinking clean water and eating uncontaminated ... help forensics labs identify criminals, test ponds and pools before ...
... Hypotheses, an Elsevier publication, has announced the winner of ... by Judith Rich-Harris, author of The Nurture Assumption and ... selection process in the evolution of human hairlessness and ... of the journal. The £1,000 prize, launched in 2004, ...
Cached Biology News:Microbes start immune response by sneaking inside cells 2Rapid, Low-Cost DNA Testing 2Rapid, Low-Cost DNA Testing 3Why aren't humans furry? Stone-Age moms could be the answer 2
(Date:8/28/2014)... DIEGO, California, USA (PRWEB) August 28, 2014 ... the Department of Physics and Optical Science and Director ... the University of North Carolina at Charlotte, and co-founder ... been elected to serve as the 2015 Vice President ... , SPIE 2014 President Philip Stahl announced recent election ...
(Date:8/28/2014)... 28, 2014 “This kit has an improved ... from 0 to 150 ppb,” said Mark Tess, PhD, Mycotoxin ... benefit to plant owners and USDA-GIPSA inspection agencies that have ... Testing can take place in a matter of minutes with ... plant test the feed and grain before accepting it, but ...
(Date:8/28/2014)... YORK , Aug. 28, ... that a new market research ... catalogue: Whole Exome ... Kits (Library Preparation, Target Enrichment), ... (Sequencing by Synthesis), by Application ...
(Date:8/28/2014)... SunTrust Robinson Humphrey (STRH) today announced the ... research team in biotechnology and oilfield services.  ... demonstrates our commitment to providing our valued institutional ... decision making," said Biff Woodruff , Head ... significant investments in differentiated content at a time ...
Breaking Biology Technology:Glenn Boreman, UNC Professor and Plasmonics Co-Founder, Elected to SPIE Presidential Chain 2Whole Exome Sequencing Market by Product (Systems, Kits (Library Preparation, Target Enrichment), by Services (Sequencing), by Technology (Sequencing by Synthesis), by Application (Cancer, Monogenic disorders) - Global Forecast to 2018 2Whole Exome Sequencing Market by Product (Systems, Kits (Library Preparation, Target Enrichment), by Services (Sequencing), by Technology (Sequencing by Synthesis), by Application (Cancer, Monogenic disorders) - Global Forecast to 2018 3Whole Exome Sequencing Market by Product (Systems, Kits (Library Preparation, Target Enrichment), by Services (Sequencing), by Technology (Sequencing by Synthesis), by Application (Cancer, Monogenic disorders) - Global Forecast to 2018 4Whole Exome Sequencing Market by Product (Systems, Kits (Library Preparation, Target Enrichment), by Services (Sequencing), by Technology (Sequencing by Synthesis), by Application (Cancer, Monogenic disorders) - Global Forecast to 2018 5Whole Exome Sequencing Market by Product (Systems, Kits (Library Preparation, Target Enrichment), by Services (Sequencing), by Technology (Sequencing by Synthesis), by Application (Cancer, Monogenic disorders) - Global Forecast to 2018 6Whole Exome Sequencing Market by Product (Systems, Kits (Library Preparation, Target Enrichment), by Services (Sequencing), by Technology (Sequencing by Synthesis), by Application (Cancer, Monogenic disorders) - Global Forecast to 2018 7Whole Exome Sequencing Market by Product (Systems, Kits (Library Preparation, Target Enrichment), by Services (Sequencing), by Technology (Sequencing by Synthesis), by Application (Cancer, Monogenic disorders) - Global Forecast to 2018 8Whole Exome Sequencing Market by Product (Systems, Kits (Library Preparation, Target Enrichment), by Services (Sequencing), by Technology (Sequencing by Synthesis), by Application (Cancer, Monogenic disorders) - Global Forecast to 2018 9Whole Exome Sequencing Market by Product (Systems, Kits (Library Preparation, Target Enrichment), by Services (Sequencing), by Technology (Sequencing by Synthesis), by Application (Cancer, Monogenic disorders) - Global Forecast to 2018 10Whole Exome Sequencing Market by Product (Systems, Kits (Library Preparation, Target Enrichment), by Services (Sequencing), by Technology (Sequencing by Synthesis), by Application (Cancer, Monogenic disorders) - Global Forecast to 2018 11Whole Exome Sequencing Market by Product (Systems, Kits (Library Preparation, Target Enrichment), by Services (Sequencing), by Technology (Sequencing by Synthesis), by Application (Cancer, Monogenic disorders) - Global Forecast to 2018 12Whole Exome Sequencing Market by Product (Systems, Kits (Library Preparation, Target Enrichment), by Services (Sequencing), by Technology (Sequencing by Synthesis), by Application (Cancer, Monogenic disorders) - Global Forecast to 2018 13SunTrust Robinson Humphrey Expands Equity Research in Healthcare and Energy 2SunTrust Robinson Humphrey Expands Equity Research in Healthcare and Energy 3