Navigation Links
Mouse Anti-PPP4C Polyclonal Antibody, Unconjugated from Abnova Corporation

ProductsMouse Anti-PPP4C Polyclonal Antibody, Unconjugated from Abnova Corporation
Company Abnova Corporation
Item Mouse Anti-PPP4C Polyclonal Antibody, Unconjugated
Price 
Description Mouse polyclonal antibody raised against a partial recombinant PPP4C.
Immunogen: PPP4C (NP_002711, 218 a.a. ~ 308 a.a) partial recombinant protein with GST tag.
Accession Number: NM_002720
Protein Sequence: GSDVVAQFNAANDIDMICRAHQLVMEGYKWHFNETVLTVWSAPNYCYRCGNVAAILELDEHLQKDFIIFEAAPQETRGIPSKKPVADYFL*
Info Abnova CorporationAbnova Corporation
Abnova Corporation (HQ)
9th Fl., No. 108, Jhouzih St.
Neihu District, Taipei
114 Taiwan R.O.C.
Tel: +886-2-8751-1888
Fax: +886-2-8751-1166

Abnova GmbH
Boxbergring 107
69126 Heidelberg
Germany
Tel: +49 6221 3632226
Fax: +49 6221 825878

Customer Service: +886-2-8751-1888
Fax Number: +886-2-8751-1166
Web Site: http://www.abnova.com.tw
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Mouse Anti-Amodiaquine Monoclonal Antibody, Unconjugated, Clone 6D10 from AntibodyShop A/S
2. Mouse Anti-Protein S Monoclonal Antibody, Unconjugated, Clone HYB 232-02 from Abcam
3. Mouse Anti-Mouse Glutathione S-transferase M1 (GSTM1) Monoclonal Antibody, Unconjugated from Lifespan Biosciences
4. Mouse Anti-Human S-100 alpha/beta chain Monoclonal Antibody, Unconjugated, Clone 8B10 from Santa Cruz Biotechnology, Inc.
5. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Testis from OriGene Technologies
6. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Brain (adult) from OriGene Technologies
7. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (12.5 - day) from OriGene Technologies
8. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (19 - day) from OriGene Technologies
9. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Thymus from OriGene Technologies
10. Mouse Anti-Human Complement factor B Monoclonal Antibody, Unconjugated, Clone 9B6 from AntibodyShop A/S
11. Mouse Anti-Human Choriongonadotropin (hCG) Monoclonal Antibody, Unconjugated, Clone 5F10 from AntibodyShop A/S
Maxi XL Hybridization Oven for Extra Large bottles. 6 bottle (70 mm) rotisserie + shaker tray available for simultaneous use. Includes linear and orbital shaker trays, 4 extra large bottles, pack o...
... Expansion Kit - Monolayer is a system designed ... a monolayer in a serum-free environment. The kit ... which has been optimized for neural stem cell ... Genes & Development 10 :3129). Human fibroblast ...
Shake 'n' Stack Oven - New Model (includes 10 bottle capacity rotisserie, adjustable feet, drip tray, manual PLUS Shaker Platform)...
... (AMV RT) catalyzes the polymerization of DNA ... (1). It requires a primer (DNA primers ... well as Mg2+ or Mn2+. The enzyme ... nonionic detergents and sulfhydryl compounds stabilize the ...
Biology Products:
(Date:4/3/2017)... WASHINGTON , April 3, 2017 /PRNewswire-USNewswire/ ... single-cell precision engineering platform, detected a statistically ... cell product prior to treatment and objective ... highlight the potential to predict whether cancer ... prior to treatment, as well as to ...
(Date:3/30/2017)... , March 30, 2017 Trends, opportunities ... (physiological and behavioral), by technology (fingerprint, AFIS, iris recognition, ... recognition, and others), by end use industry (government and ... immigration, financial and banking, and others), and by region ... , Asia Pacific , and ...
(Date:3/27/2017)... , March 27, 2017  Catholic Health Services ... Management Systems Society (HIMSS) Analytics for achieving Stage ... Model sm . In addition, CHS previously earned ... hospitals using an electronic medical record (EMR). ... high level of EMR usage in an outpatient ...
Breaking Biology News(10 mins):
(Date:8/21/2017)... ... August 21, 2017 , ... Baltimore biotech firm, PathSensors, ... to bring its proprietary CANARY pathogen detection technology and high throughput testing solutions ... has purchased an undisclosed number of PathSensors’ Zephyr pathogen detection instruments and will ...
(Date:8/21/2017)... ... August 21, 2017 , ... ... speakers for this two-part educational webinar, in which attendees will learn about the ... protein factor composition. Along with an overview of the development and validation of ...
(Date:8/18/2017)... ... August 18, 2017 , ... ... they will feature Federal Hybrids, Inc. in an upcoming episode, scheduled to broadcast ... American Farmer will explore Federal Hybrids, the independent, family-owned seed company. Educating audiences ...
(Date:8/17/2017)... ... August 17, 2017 , ... ... news outlet had provided a research update on Aytu Bioscience and cited promising ... , According to Soulstring, prescription rates for Natesto® have more than doubled since ...
Breaking Biology Technology: