Navigation Links
Mouse Anti-PPP4C Polyclonal Antibody, Unconjugated from Abnova Corporation

ProductsMouse Anti-PPP4C Polyclonal Antibody, Unconjugated from Abnova Corporation
Company Abnova Corporation
Item Mouse Anti-PPP4C Polyclonal Antibody, Unconjugated
Price 
Description Mouse polyclonal antibody raised against a partial recombinant PPP4C.
Immunogen: PPP4C (NP_002711, 218 a.a. ~ 308 a.a) partial recombinant protein with GST tag.
Accession Number: NM_002720
Protein Sequence: GSDVVAQFNAANDIDMICRAHQLVMEGYKWHFNETVLTVWSAPNYCYRCGNVAAILELDEHLQKDFIIFEAAPQETRGIPSKKPVADYFL*
Info Abnova CorporationAbnova Corporation
Abnova Corporation (HQ)
9th Fl., No. 108, Jhouzih St.
Neihu District, Taipei
114 Taiwan R.O.C.
Tel: +886-2-8751-1888
Fax: +886-2-8751-1166

Abnova GmbH
Boxbergring 107
69126 Heidelberg
Germany
Tel: +49 6221 3632226
Fax: +49 6221 825878

Customer Service: +886-2-8751-1888
Fax Number: +886-2-8751-1166
Web Site: http://www.abnova.com.tw
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Mouse Anti-Amodiaquine Monoclonal Antibody, Unconjugated, Clone 6D10 from AntibodyShop A/S
2. Mouse Anti-Protein S Monoclonal Antibody, Unconjugated, Clone HYB 232-02 from Abcam
3. Mouse Anti-Mouse Glutathione S-transferase M1 (GSTM1) Monoclonal Antibody, Unconjugated from Lifespan Biosciences
4. Mouse Anti-Human S-100 alpha/beta chain Monoclonal Antibody, Unconjugated, Clone 8B10 from Santa Cruz Biotechnology, Inc.
5. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Testis from OriGene Technologies
6. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Brain (adult) from OriGene Technologies
7. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (12.5 - day) from OriGene Technologies
8. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (19 - day) from OriGene Technologies
9. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Thymus from OriGene Technologies
10. Mouse Anti-Human Complement factor B Monoclonal Antibody, Unconjugated, Clone 9B6 from AntibodyShop A/S
11. Mouse Anti-Human Choriongonadotropin (hCG) Monoclonal Antibody, Unconjugated, Clone 5F10 from AntibodyShop A/S
One-step, microplate or cuvet, turbidometric, linear detection range 0.096 mg/dL to 11.5 mg/dL. Procedure: 5 min....
Homo sapiens 4-aminobutyrate aminotransferase Antigen: Recombinant Protein...
Request Info...
...
Biology Products:
(Date:7/9/2015)... SAN JOSE, Calif. , July 9, ... ), the leading developer of human interface ... authentication technology, the industry,s first fully hardware ... innovative Match-in-Sensor secure authentication technology is literally ... pattern storage and biometric matching within the ...
(Date:7/8/2015)... SAN DIEGO , July 8, 2015 /PRNewswire/ ... of cell-free molecular diagnostics, today announced the launch ... of the Company,s Precision Cancer Monitoring℠ (PCM) technology ... patients receiving one or a combination of the ... and Opdivo® (nivolumab), a PD-1 inhibitor. The 50-patient ...
(Date:7/7/2015)... , July 7, 2015  Based on its ... & Sullivan recognizes Credence ID, LLC with the ... Company of the Year Award. Credence ID has ... in its mission of offering enrollment and identification ... As Credence ID was formed by experts from ...
Breaking Biology News(10 mins):Synaptics Announces World's First Match-in-Sensor Fingerprint Authentication Technology 2Synaptics Announces World's First Match-in-Sensor Fingerprint Authentication Technology 3Trovagene Initiates Study to Monitor Response to Immunotherapy in Melanoma Patients Using its Precision Cancer Monitoring Platform 2Trovagene Initiates Study to Monitor Response to Immunotherapy in Melanoma Patients Using its Precision Cancer Monitoring Platform 3Trovagene Initiates Study to Monitor Response to Immunotherapy in Melanoma Patients Using its Precision Cancer Monitoring Platform 4Frost & Sullivan Acknowledges the Distinctive Customer-focused Attributes of Credence ID's Mobile Biometric Product Suite 2Frost & Sullivan Acknowledges the Distinctive Customer-focused Attributes of Credence ID's Mobile Biometric Product Suite 3Frost & Sullivan Acknowledges the Distinctive Customer-focused Attributes of Credence ID's Mobile Biometric Product Suite 4Frost & Sullivan Acknowledges the Distinctive Customer-focused Attributes of Credence ID's Mobile Biometric Product Suite 5
... personalized medicine for Parkinson,s disease, by investigating signs of ... cells respond to drug treatments. The study was funded ... collected skin cells from patients with genetically inherited forms ... They found that neurons derived from individuals with distinct ...
... is the way to go, if you are a primate ... orangutans, researchers have measured the energy required to navigate a ... up in the trees. Their work was presented at the ... July 2012. The findings help us to understand ...
... Laboratory of Neuro Imaging (LONI) has been responsible for ... generated by the Alzheimer,s Disease Neuroimaging Initiative (ADNI), an ... of Alzheimer,s disease. That stream of ... partners with an ambitious publicprivate effort to dig deeper ...
Cached Biology News:Patient-derived stem cells could improve drug research for Parkinson's 2Patient-derived stem cells could improve drug research for Parkinson's 3Patient-derived stem cells could improve drug research for Parkinson's 4Revolutionary project will obtain entire genome sequences in fight against Alzheimer's 2Revolutionary project will obtain entire genome sequences in fight against Alzheimer's 3
(Date:7/27/2015)... ... 27, 2015 , ... Brady (NYSE:BRC), a global ... 3 Ways to GHS Labels . This video provides useful information on how ... by effectively labeling chemical containers. , “With the fourth and final deadline for ...
(Date:7/27/2015)... WORTH, Texas , July 27, 2015 ... Media Market by Type (Home-brew Media, Pre-formulated Media), by Application ... America , Europe , ... Forecast to 2019", The global biopreservation media market was valued ... to around $571.5 million by 2019, at a CAGR of ...
(Date:7/27/2015)... ... July 27, 2015 , ... Visual Assay was named as ... top 100 most innovative technologies and services of the past year. More than 70 ... Software/Services category. The winners will be announced at the 2015 R&D 100 Awards Dinner ...
(Date:7/24/2015)... San Diego, CA (PRWEB) , ... July 24, 2015 , ... ... Hospital & Referral Center in support of stem cell therapy training and clinical opportunities. ... offer this new opportunity to veterinarians in the San Diego area. Stem cell therapy ...
Breaking Biology Technology:Brady Releases “3 Roads to GHS Labels” Video 2Global Biopreservation Media Market to be Worth $571.5 Million by 2019 2Global Biopreservation Media Market to be Worth $571.5 Million by 2019 3Visual Assay® Named Finalist in 53rd Annual R&D 100 Awards 2VetStem Biopharma, proudly announces a new long term partnership with VCA Emergency Animal Hospital & Referral Center. 2VetStem Biopharma, proudly announces a new long term partnership with VCA Emergency Animal Hospital & Referral Center. 3