Navigation Links
Mouse Anti-PPP4C Polyclonal Antibody, Unconjugated from Abnova Corporation

ProductsMouse Anti-PPP4C Polyclonal Antibody, Unconjugated from Abnova Corporation
Company Abnova Corporation
Item Mouse Anti-PPP4C Polyclonal Antibody, Unconjugated
Price 
Description Mouse polyclonal antibody raised against a partial recombinant PPP4C.
Immunogen: PPP4C (NP_002711, 218 a.a. ~ 308 a.a) partial recombinant protein with GST tag.
Accession Number: NM_002720
Protein Sequence: GSDVVAQFNAANDIDMICRAHQLVMEGYKWHFNETVLTVWSAPNYCYRCGNVAAILELDEHLQKDFIIFEAAPQETRGIPSKKPVADYFL*
Info Abnova CorporationAbnova Corporation
Abnova Corporation (HQ)
9th Fl., No. 108, Jhouzih St.
Neihu District, Taipei
114 Taiwan R.O.C.
Tel: +886-2-8751-1888
Fax: +886-2-8751-1166

Abnova GmbH
Boxbergring 107
69126 Heidelberg
Germany
Tel: +49 6221 3632226
Fax: +49 6221 825878

Customer Service: +886-2-8751-1888
Fax Number: +886-2-8751-1166
Web Site: http://www.abnova.com.tw
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Mouse Anti-Amodiaquine Monoclonal Antibody, Unconjugated, Clone 6D10 from AntibodyShop A/S
2. Mouse Anti-Protein S Monoclonal Antibody, Unconjugated, Clone HYB 232-02 from Abcam
3. Mouse Anti-Mouse Glutathione S-transferase M1 (GSTM1) Monoclonal Antibody, Unconjugated from Lifespan Biosciences
4. Mouse Anti-Human S-100 alpha/beta chain Monoclonal Antibody, Unconjugated, Clone 8B10 from Santa Cruz Biotechnology, Inc.
5. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Testis from OriGene Technologies
6. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Brain (adult) from OriGene Technologies
7. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (12.5 - day) from OriGene Technologies
8. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (19 - day) from OriGene Technologies
9. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Thymus from OriGene Technologies
10. Mouse Anti-Human Complement factor B Monoclonal Antibody, Unconjugated, Clone 9B6 from AntibodyShop A/S
11. Mouse Anti-Human Choriongonadotropin (hCG) Monoclonal Antibody, Unconjugated, Clone 5F10 from AntibodyShop A/S
Request Info...
The Proteome Profiler Human Phospho-MAPK Array Kit contains 4 membranes - each spotted in duplicate with 23 different MAPK antibodies....
... clone d1-174 GenBank Accession Number : ... N-terminal tagged fusion protein corresponding to full ... Tris-glycine, pH 7.4, 0.15M NaCl, 0.05% sodium ... 30% Quality Assurance: routinely evaluated by immunoblot ...
Rat CXCL7/Thymus Chemokine-1 DuoSet Economy Pack, 45 Plate...
Biology Products:
(Date:5/28/2015)... , May 28, 2015 Industry ... of a new report titled "Markets for Self-Healing ... polymers, inorganic capsule and vascular systems, biomaterials, relevant ... grow to around $2.7 billion by 2020. ... n-tech,s extensive coverage of smart materials. Other recent n-tech ...
(Date:5/27/2015)...   Codonics (codonics.com), a global ... documentation solutions and Omnicell  (omnicell.com), a ... is pleased to announce their state of ... System® (SLS), an award-winning FDA class 2 ... Anesthesia Workstation, helps prevent medication errors, streamlines ...
(Date:5/26/2015)... May 26, 2015 Research ... addition of the "Saudi Arabia Biometric Systems ... their offering. ,     (Logo: http://photos.prnewswire.com/prnh/20130307/600769) , ,The biometric ... is projected to grow at over 22% ... is attributed to the surging demand for better ...
Breaking Biology News(10 mins):The Market for Self-Healing Materials to Reach $2.7 Billion by 2020 Says New n-tech Research Study 2The Market for Self-Healing Materials to Reach $2.7 Billion by 2020 Says New n-tech Research Study 3Codonics and Omnicell Expand Partnership 2Codonics and Omnicell Expand Partnership 3Codonics and Omnicell Expand Partnership 4Saudi Arabia Biometric Systems Market Forecast and Opportunities, 2020 with Morpho Safran, ZK Technlogy, and Suprema Dominating 2
... Why should we care about butterflies and moths? Thanks to ... plants are able to reproduce and bear fruit. That very ... foods we eat. And, not least, pollination adds to the ... is evidence of alarming pollinator population declines worldwide. Fortunately, science ...
... In the thick of whale season, researchers from Hawai,i ... and Atmospheric Administration (NOAA) shed new light on the ... ground for the North Pacific was always thought to ... study has shown that these grounds extend all the ...
... WASHINGTON, D.C. (March 8, 2011) -- Researchers at ... University of Texas at Dallas are reporting today at ... MD how they are using a novel 3D cell ... protein transport, providing a solution to this fundamental problem ...
Cached Biology News:Internet catches updated butterfly and moth website 2Researchers discover new wintering grounds for humpback whales using sound 2
(Date:5/28/2015)... 2015 Research and ... of Jain PharmaBiotech,s new report  "Alzheimer Disease ... their offering.       (Logo: http://photos.prnewswire.com/prnh/20130307/600769) ... in management. With nearly 8 million sufferers ... markets of the world and anticipated increases ...
(Date:5/28/2015)... DUBLIN , May 28, 2015 /PRNewswire/ ... http://www.researchandmarkets.com/research/7k46bt/therapeutic_drug ) has announced the addition of ... Monitoring - Technologies, Markets, and Companies" ... http://photos.prnewswire.com/prnh/20130307/600769) , This report deals ... specialty, aimed at improving patient care by ...
(Date:5/28/2015)... N.J. , May 28, 2015  Quest Diagnostics ... of diagnostic information services, announced that it is scheduled ... in New York.  Steve Rusckowski , the company,s ... and five point strategy.  The presentation is scheduled for ... The presentation will be webcast live during ...
(Date:5/28/2015)... May 28, 2015 ... has announced the addition of Jain ... Technologies, Markets and Companies"  to their ... report describes and evaluates animal biotechnology ... and pharmaceuticals as well as improvement ...
Breaking Biology Technology:Global Alzheimer Disease Report 2015-2024 - New Drugs, Markets and Companies 2Global Alzheimer Disease Report 2015-2024 - New Drugs, Markets and Companies 3Global Therapeutic Drug Monitoring Market 2015-2024 2Quest Diagnostics to Speak at the Jefferies 2015 Global Healthcare Conference 2Global Animal Biotechnology Report 2015 - Technologies, Markets and Companies Analysis to 2024 2Global Animal Biotechnology Report 2015 - Technologies, Markets and Companies Analysis to 2024 3