Navigation Links
Mouse Anti-PPP4C Polyclonal Antibody, Unconjugated from Abnova Corporation

ProductsMouse Anti-PPP4C Polyclonal Antibody, Unconjugated from Abnova Corporation
Company Abnova Corporation
Item Mouse Anti-PPP4C Polyclonal Antibody, Unconjugated
Price 
Description Mouse polyclonal antibody raised against a partial recombinant PPP4C.
Immunogen: PPP4C (NP_002711, 218 a.a. ~ 308 a.a) partial recombinant protein with GST tag.
Accession Number: NM_002720
Protein Sequence: GSDVVAQFNAANDIDMICRAHQLVMEGYKWHFNETVLTVWSAPNYCYRCGNVAAILELDEHLQKDFIIFEAAPQETRGIPSKKPVADYFL*
Info Abnova CorporationAbnova Corporation
Abnova Corporation (HQ)
9th Fl., No. 108, Jhouzih St.
Neihu District, Taipei
114 Taiwan R.O.C.
Tel: +886-2-8751-1888
Fax: +886-2-8751-1166

Abnova GmbH
Boxbergring 107
69126 Heidelberg
Germany
Tel: +49 6221 3632226
Fax: +49 6221 825878

Customer Service: +886-2-8751-1888
Fax Number: +886-2-8751-1166
Web Site: http://www.abnova.com.tw
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Mouse Anti-Amodiaquine Monoclonal Antibody, Unconjugated, Clone 6D10 from AntibodyShop A/S
2. Mouse Anti-Protein S Monoclonal Antibody, Unconjugated, Clone HYB 232-02 from Abcam
3. Mouse Anti-Mouse Glutathione S-transferase M1 (GSTM1) Monoclonal Antibody, Unconjugated from Lifespan Biosciences
4. Mouse Anti-Human S-100 alpha/beta chain Monoclonal Antibody, Unconjugated, Clone 8B10 from Santa Cruz Biotechnology, Inc.
5. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Testis from OriGene Technologies
6. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Brain (adult) from OriGene Technologies
7. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (12.5 - day) from OriGene Technologies
8. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (19 - day) from OriGene Technologies
9. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Thymus from OriGene Technologies
10. Mouse Anti-Human Complement factor B Monoclonal Antibody, Unconjugated, Clone 9B6 from AntibodyShop A/S
11. Mouse Anti-Human Choriongonadotropin (hCG) Monoclonal Antibody, Unconjugated, Clone 5F10 from AntibodyShop A/S
Chaperone Sampler Kit 10 mu g each...
Zonula Adherens Sampler Kit 10 mu g each...
Tumor Suppressor Sampler Kit 10 mu g each...
Umbilical cord blood eosinophils, For immunohistochemistry (IHC)...
Biology Products:
(Date:11/21/2014)... , Nov. 20, 2014 C-Labs LLC, ... the Internet of Things (IoT), today announced the appointment ... chief operating officer. Previously a strategic advisor to the ... and operations. Mr. Traynor is based out of the ... He reports to Chris Muench , Chief Executive ...
(Date:11/18/2014)...  The Secure Identity & Biometrics Association (SIBA) ... the formation of The Airport Entry and Exit ... and Biometric Entry and Exit Solutions Framework for ... from BORDERPOL, the international non-profit organization that works ... regarding border security, traveler and migration systems. ...
(Date:11/18/2014)... The Parenteral Drug Association (PDA) today confirmed that ... and at least seven more will participate in the upcoming ... Hotel in Washington D.C. , Dec. 2-4. ... support from the regulatory agencies in the United ... our effort to help advance the use of metrics in ...
Breaking Biology News(10 mins):C-Labs Names Former Microsoft and Bsquare Executive as Chief Operating Officer 2Identity Management, Document Authentication and Biometric Companies Form "The Airport Entry and Exit Working Group", Releasing the Framework to Help Guide the Department of Homeland Security and Congress Towards Solutions 2Identity Management, Document Authentication and Biometric Companies Form "The Airport Entry and Exit Working Group", Releasing the Framework to Help Guide the Department of Homeland Security and Congress Towards Solutions 3FDA's Janet Woodcock, EMA's Emer Cooke Headline PDA Quality Metrics Conference 2
... 2013, Shenzhen, China-The China National Genebank (CNGB) announces ... Project (Fish T1K), a groundbreaking transcriptome study designed ... and diversification of the largest group of vertebrates. ... approaches and strategies to address challenges in fish ...
... 650 years of annual change in sea-ice cover can been ... says a new study from the University of Toronto Mississauga ... have been used to track changes in Arctic sea ice," ... Chemical and Physical Sciences. "We found the algal record shows ...
... City, November 18, 2013 Ph.D. student Karita ... Environnement Research Centre, in collaboration with other Canadian, ... emissions produced by thawing permafrost in the Canadian ... climate models. Their findings, published in the journal ...
Cached Biology News:China National Genebank initiates collaboration to sequence transcriptomes of 1,000 fish species 2Underwater 'tree rings' 2Global warming in the Canadian Arctic 2
(Date:12/24/2014)... , Dec. 23, 2014  Rock Creek Pharmaceuticals, Inc., ... has filed a Clinical Trial Application (CTA) with the ... Regulatory Agency (MHRA) seeking regulatory approval to initiate clinical ... Anatabine Citrate. Contingent on the Company receiving ... Phase I trial to assess the safety, tolerability and ...
(Date:12/22/2014)... , Dec. 22, 2014  Alternative Energy ... that it has signed a letter of intent ... has developed and patented a nanotechnology-based development platform ... products that enable rapid on-site collection and testing ... and health issues in an immediate, non-invasive and ...
(Date:12/22/2014)... 22, 2014 Fertility Associates of Memphis ... Bank USA , a network of more than 20 ... partnership, patients have fast access to a national pool ... IVF . Fertility Associates of Memphis is the only ... treatment option. , Dr. William Kutteh , director ...
(Date:12/19/2014)... 19, 2014  Roche (SIX: RO, ROG; OTCQX: RHHBY) ... (Bina), a privately held company based in ... provides a big data platform for centralized management ... Bina,s proprietary on-market Genomic Management Solution, Bina-GMS 1 ... perform fast and scalable analyses to maximize the ...
Breaking Biology Technology:Rock Creek Pharmaceuticals Files Clinical Trial Application in the UK for Clinical Trials of Anatabine Citrate Formulations 2Rock Creek Pharmaceuticals Files Clinical Trial Application in the UK for Clinical Trials of Anatabine Citrate Formulations 3ALNE Announces Intention To Acquire BioTechPharma 2Fertility Associates of Memphis Announces Partnership with Donor Egg Bank USA 2Fertility Associates of Memphis Announces Partnership with Donor Egg Bank USA 3Roche acquires Bina Technologies and enters the genomic informatics market 2Roche acquires Bina Technologies and enters the genomic informatics market 3