Mouse Anti-PPP4C Polyclonal Antibody, Unconjugated from Abnova Corporation

Multiskan EX from Thermo Scientific

... a multi-tasking vacuum source and solvent recover... trap and a maintenance-free, oil-free vacuum pump...e-mouth glass condensation flask collects all the ...l. The UVS400 provides an ideal vacuum system for ...

Mouse Anti-Ubiquitin, Multi Monoclonal Antibody, Unconjugated, Clone FK2 from Assay Designs/Stressgen Bioreagents

Goat Anti-Lysozyme C (W-20) Polyclonal Antibody, Unconjugated from Santa Cruz Biotechnology, Inc.

Biology Products:

Multiskan EX from Thermo Scientific UVS400 Universal Vacuum System from Thermo Scientific Mouse Anti-Ubiquitin, Multi Monoclonal Antibody, Unconjugated, Clone FK2 from Assay Designs/Stressgen Bioreagents Goat Anti-Lysozyme C (W-20) Polyclonal Antibody, Unconjugated from Santa Cruz Biotechnology, Inc.

(Date:11/24/2009)... class of ring-shaped protein motors has been unco...tional Laboratory (Berkeley Lab) using a state-of-...vanced Light Source (ALS). These protein motors pl...n, and are vital to the survival of all biological...human papillomavirus, which has been linked to cer...

(Date:11/24/2009)...2009) -- The Wildlife Conservation Society (WCS) a...maining population of Siberian tigers has likely d...aching and habitat loss. , WCS says ...hat needs to be done to protect remaining populati...he report was released by the Siberian Tiger Monit...

(Date:11/24/2009)... of debate. A high-profile study a few years ago s...carbon from trees and leaves, evidence for a very ...systems. , But new research from the University ... Algae provide a much richer diet for fish and oth...his week in the Proceedings of the National Acade...

Breaking Biology News(10 mins):Atomic-level snapshot catches protein motor in action 2 Atomic-level snapshot catches protein motor in action 3 Atomic-level snapshot catches protein motor in action 4 Report shows dramatic decline in Siberian tigers 2 Fish food fight: Fish don't eat trees after all, says new study 2 Fish food fight: Fish don't eat trees after all, says new study 3 Veran Medical Technologies Announces Intellectual Property Agreement With Medtronic 47443 1 Veran Medical Technologies Announces Intellectual Property Agreement With Medtronic 47443 2 Unprecedented Merger Occurs in Retained Physician Search Industry 47441 1 Unprecedented Merger Occurs in Retained Physician Search Industry 47441 2 Unprecedented Merger Occurs in Retained Physician Search Industry 47441 3 PROSTVAC 28TM 29 Data Presented at the ASCO Meeting Demonstrates the Potential for Significant Increases in Life Expectancy in Late Stage Prostate Can 12379 1 PROSTVAC 28TM 29 Data Presented at the ASCO Meeting Demonstrates the Potential for Significant Increases in Life Expectancy in Late Stage Prostate Can 12379 2 PROSTVAC 28TM 29 Data Presented at the ASCO Meeting Demonstrates the Potential for Significant Increases in Life Expectancy in Late Stage Prostate Can 12379 3

[1] Atomic-level snapshot catches protein motor in action [1] Report shows dramatic decline in Siberian tigers [0] Fish food fight: Fish don't eat trees after all, says new study

...ernational research team has compiled the first ca...hundreds of inherited diseases. These results prov...h as breast cancer, Parkinson,s disease, heart dis...e Technical University of Denmark and Massachusett...edings of the National Academy of Sciences and ha...

..., December 15, 2008.- According to an internationa...r, citizens in advanced societies view assisted re...ilization in particular as firmly acceptable alter... points on an acceptance scale from 0 to 10 in twe...s strong approval for in vitro fertilization dissi...

...TON, Dec. 17 - In pursuing cleaner energy there is...roalgae, for instance, can be considered too green...Express , the Optical Society,s (OSA) open-access ...a, Berkeley describe a method for using microalgae... to genetically modify the tiny organisms, so as t...

Other Biology News:Researchers compile 'molecular manual' for 100s of inherited diseases 2 Attitudes towards assisted reproduction and preimplantation genetic diagnosis 2 Attitudes towards assisted reproduction and preimplantation genetic diagnosis 3 Attitudes towards assisted reproduction and preimplantation genetic diagnosis 4 Engineering algae to make fuel instead of sugar 2

Researchers compile 'molecular manual' for 100s of inherited diseases Attitudes towards assisted reproduction and preimplantation genetic diagnosis Engineering algae to make fuel instead of sugar

(Date:11/24/2009)... Health care employment gr...s the only one to show consistent growth during th...ospitals remain in trouble, and health systems are...ersonnel, instead of just administrators. , ...alth care employment continued growing in October ...

(Date:11/24/2009)..., SEATTLE,Nov.24/PRNewswire/--BlueMarbleEnergyC...DevelopmentAuthority(OPDA)wererecentlyawarded$2mil...tionBoard(CERB)inaprivate/publicpartnershiptoconst...inLincolnCounty,WA. ,, "Thisinvestmentwillsigni...gover70greenjobstoLincolnCounty,"saidBlueMarbleEne...

(Date:11/24/2009)..., SANDIEGO,Nov.24,2009/PRNewswire-FirstCall/--A...todaythatthecompanyisscheduledtopresentatthePiperJ...09at11:30a.m.EasternTime(8:30a.m.PacificTime)atthe...resident andChiefExecutiveOfficer,isscheduledtopro...elopmentanddiscoveryprograms. ,, Aliveaudiowebc...

(Date:11/24/2009)..., SEATTLE,Nov.24/PRNewswire-FirstCall/--CellThe...llpresentatthe21stAnnualPiperJaffrayHealthCareConf...heNewYorkPalaceHotel. ,, CTIwillpresentonTuesda...r).AliveaudiowebcastofCTI,spresentationwillbeavail...ailableforreplayafterwards. , ,PiperJaffrayHealth...

Breaking Biology Technology:The MedZilla Report for October 2009 - Health Care Employment Grows Again in October Even As Clinics, Specialty Centers Close 2 The MedZilla Report for October 2009 - Health Care Employment Grows Again in October Even As Clinics, Specialty Centers Close 3 The MedZilla Report for October 2009 - Health Care Employment Grows Again in October Even As Clinics, Specialty Centers Close 4 Blue Marble Energy, OPDA Awarded $2M by WA's Community Economic Revitalization Board 2 Arena Pharmaceuticals to Present at the Piper Jaffray 21st Annual Health Care Conference 2

[0] The MedZilla Report for October 2009 - Health Care Employment Grows Again in October Even As Clinics, Specialty Centers Close [0] Blue Marble Energy, OPDA Awarded $2M by WA's Community Economic Revitalization Board [0] Arena Pharmaceuticals to Present at the Piper Jaffray 21st Annual Health Care Conference [0] Cell Therapeutics, Inc. (CTI) to Present at 21st Annual Piper Jaffray Health Care Conference

Products	Mouse Anti-PPP4C Polyclonal Antibody, Unconjugated from Abnova Corporation
Company	Abnova Corporation
Item	Mouse Anti-PPP4C Polyclonal Antibody, Unconjugated
Price
Description	Mouse polyclonal antibody raised against a partial recombinant PPP4C. Immunogen: PPP4C (NP_002711, 218 a.a. ~ 308 a.a) partial recombinant protein with GST tag. Accession Number: NM_002720 Protein Sequence: GSDVVAQFNAANDIDMICRAHQLVMEGYKWHFNETVLTVWSAPNYCYRCGNVAAILELDEHLQKDFIIFEAAPQETRGIPSKKPVADYFL*
Info	Abnova Corporation Abnova Corporation (HQ) 9th Fl., No. 108, Jhouzih St. Neihu District, Taipei 114 Taiwan R.O.C. Tel: +886-2-8751-1888 Fax: +886-2-8751-1166 Abnova GmbH Boxbergring 107 69126 Heidelberg Germany Tel: +49 6221 3632226 Fax: +49 6221 825878 Customer Service: +886-2-8751-1888 Fax Number: +886-2-8751-1166 Web Site: http://www.abnova.com.tw