Navigation Links
Mouse Anti-PPP4C Polyclonal Antibody, Unconjugated from Abnova Corporation

ProductsMouse Anti-PPP4C Polyclonal Antibody, Unconjugated from Abnova Corporation
Company Abnova Corporation
Item Mouse Anti-PPP4C Polyclonal Antibody, Unconjugated
Price 
Description Mouse polyclonal antibody raised against a partial recombinant PPP4C.
Immunogen: PPP4C (NP_002711, 218 a.a. ~ 308 a.a) partial recombinant protein with GST tag.
Accession Number: NM_002720
Protein Sequence: GSDVVAQFNAANDIDMICRAHQLVMEGYKWHFNETVLTVWSAPNYCYRCGNVAAILELDEHLQKDFIIFEAAPQETRGIPSKKPVADYFL*
Info Abnova CorporationAbnova Corporation
Abnova Corporation (HQ)
9th Fl., No. 108, Jhouzih St.
Neihu District, Taipei
114 Taiwan R.O.C.
Tel: +886-2-8751-1888
Fax: +886-2-8751-1166

Abnova GmbH
Boxbergring 107
69126 Heidelberg
Germany
Tel: +49 6221 3632226
Fax: +49 6221 825878

Customer Service: +886-2-8751-1888
Fax Number: +886-2-8751-1166
Web Site: http://www.abnova.com.tw
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Mouse Anti-Amodiaquine Monoclonal Antibody, Unconjugated, Clone 6D10 from AntibodyShop A/S
2. Mouse Anti-Protein S Monoclonal Antibody, Unconjugated, Clone HYB 232-02 from Abcam
3. Mouse Anti-Mouse Glutathione S-transferase M1 (GSTM1) Monoclonal Antibody, Unconjugated from Lifespan Biosciences
4. Mouse Anti-Human S-100 alpha/beta chain Monoclonal Antibody, Unconjugated, Clone 8B10 from Santa Cruz Biotechnology, Inc.
5. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Testis from OriGene Technologies
6. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Brain (adult) from OriGene Technologies
7. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (12.5 - day) from OriGene Technologies
8. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (19 - day) from OriGene Technologies
9. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Thymus from OriGene Technologies
10. Mouse Anti-Human Complement factor B Monoclonal Antibody, Unconjugated, Clone 9B6 from AntibodyShop A/S
11. Mouse Anti-Human Choriongonadotropin (hCG) Monoclonal Antibody, Unconjugated, Clone 5F10 from AntibodyShop A/S
... commonly used technique for studying protein function ... on SDS-PAGE and transferred to a membrane ... are probed with specific antibodies. Unlike nucleic ... Southern and Northern blots, it has been ...
... System, Basic Package Superior Protein Detection ... The ProXPRESS 2D Proteomic Imaging System is ... both proteomic and general life science research ... the use of all dyes in the ...
... our Regulatory Edition of Molecular Imaging (MI) ... for life science research and drug discovery ... with U.S. Food and Drug Administrations Code ... Electronic Records; Electronic Signatures [21 CFR Part ...
... OPA1-01009, OPEP-01009 is a 16 amino acid (amino acids 3-18) ... (DFF). The sequence of this peptide is (amino to ... S - V - K - L - R - ... R - K(18). This peptide may be used ...
Biology Products:
(Date:7/30/2014)... Washington, DCToday scientists unveiled the first high-resolution map ... the entire country of Per. The new and ... a sea change for future market-based carbon economies. ... extremely high ecological diversity and it provides the ... degradation for conservation, land use, and enforcement purposes. ...
(Date:7/29/2014)... in the University of Bristol,s Nutrition and Behaviour Unit ... into account when planning meals. , The research, to ... Ingestive Behavior Conference (SSIB 2014) in Seattle, USA this ... do. , The team was led by Professor Jeff ... Psychology. , As part of a Biotechnology and Biological ...
(Date:7/29/2014)... warms and sea ice retreats, the North is changing. ... open water which is predicted to extend across the ... Storms thus have the potential to create Arctic swell ... unpredictable element to the region. , A University of Washington ... middle of the Arctic Ocean, and detected house-sized waves ...
Breaking Biology News(10 mins):Peru's carbon quantified: Economic and conservation boon 2Peru's carbon quantified: Economic and conservation boon 3Huge waves measured for first time in Arctic Ocean 2Huge waves measured for first time in Arctic Ocean 3
... GEOLOGY ends 2012 with 23 new articles spanning ... Naica Cave, Mexico; Diamantina, Brazil; the Galpagos hotspot; China; ... central West Greenland; the California arc; the Pacific Ring ... Sierra Nevada; Spain; New Zealand; Turkey; Connecticut, USA; and ...
... the extinct giant piranha, or megapiranha, have the most ... body size is taken into account, finds researchers in ... The research paper, Mega-Bites: Extreme jaw forces of living ... which allows them to attack and bite chunks out ...
... RICHLAND, Wash. Pacific Northwest National Laboratory has been ... large amounts of renewable energy until it,s needed, fight ... to the marketplace. The Federal Laboratory Consortium announced ... Richland is receiving three 2013 Excellence in Technology Transfer ...
Cached Biology News:GEOLOGY returns to Naica Cave, Mexico, and extends its reach to Mercury 2GEOLOGY returns to Naica Cave, Mexico, and extends its reach to Mercury 3GEOLOGY returns to Naica Cave, Mexico, and extends its reach to Mercury 4GEOLOGY returns to Naica Cave, Mexico, and extends its reach to Mercury 5GEOLOGY returns to Naica Cave, Mexico, and extends its reach to Mercury 6GEOLOGY returns to Naica Cave, Mexico, and extends its reach to Mercury 7GEOLOGY returns to Naica Cave, Mexico, and extends its reach to Mercury 8GEOLOGY returns to Naica Cave, Mexico, and extends its reach to Mercury 9GEOLOGY returns to Naica Cave, Mexico, and extends its reach to Mercury 10GEOLOGY returns to Naica Cave, Mexico, and extends its reach to Mercury 11GEOLOGY returns to Naica Cave, Mexico, and extends its reach to Mercury 12GEOLOGY returns to Naica Cave, Mexico, and extends its reach to Mercury 13GEOLOGY returns to Naica Cave, Mexico, and extends its reach to Mercury 14GEOLOGY returns to Naica Cave, Mexico, and extends its reach to Mercury 15GEOLOGY returns to Naica Cave, Mexico, and extends its reach to Mercury 16GEOLOGY returns to Naica Cave, Mexico, and extends its reach to Mercury 17GEOLOGY returns to Naica Cave, Mexico, and extends its reach to Mercury 18GEOLOGY returns to Naica Cave, Mexico, and extends its reach to Mercury 19GEOLOGY returns to Naica Cave, Mexico, and extends its reach to Mercury 20Black piranha, megapiranha have most powerful bites of fish living or extinct, finds GW researcher 2PNNL recognized for transferring innovations to the marketplace 2PNNL recognized for transferring innovations to the marketplace 3
(Date:7/29/2014)... SoundConnect , an award winning ... to announce the strategic additions of implementation, support, ... Charleston and Atlanta offices. SoundConnect’s organizational expansion ... hosted solutions, collaboration and mobility that improve business ... SoundConnect was founded in 2004, with the mission ...
(Date:7/29/2014)... (PRWEB) July 29, 2014 The advanced ... the brain that are driving a revolution in the ... new peer-reviewed journal published by SPIE, the international ... issue coincides with the launch of the BRAIN Initiative ... articles that lay out a vision for and provide ...
(Date:7/29/2014)... The Quantum Cheshire Cat: Can a particle be separated ... Nature Communications , published the results of the ... magnetic field, conducted by Chapman University in Orange, CA, ... often seen a cat without a grin," thought Alice ... the most curious thing I ever saw in my ...
(Date:7/29/2014)... , July 29, 2014  The Society ... new and updated program for the 9 th ... 12, 2014 in Amelia Island , Florida.  ... and investigators remains unchanged, however, the topics and ... and networking opportunity among all stakeholders with a ...
Breaking Biology Technology:SoundConnect Organization and Culture is Evolving 2SPIE Launches 'Neurophotonics' Journal with Special Section on BRAIN Initiative 2SPIE Launches 'Neurophotonics' Journal with Special Section on BRAIN Initiative 3SPIE Launches 'Neurophotonics' Journal with Special Section on BRAIN Initiative 4The quantum Cheshire cat: Scientists separate a particle from its properties 2The quantum Cheshire cat: Scientists separate a particle from its properties 3The quantum Cheshire cat: Scientists separate a particle from its properties 4TransCelerate, Lilly, Pfizer, and FDA Highlight Collaborative Program at the Site Solutions Summit 2TransCelerate, Lilly, Pfizer, and FDA Highlight Collaborative Program at the Site Solutions Summit 3