Navigation Links
Mouse Anti-PPP4C Polyclonal Antibody, Unconjugated from Abnova Corporation

ProductsMouse Anti-PPP4C Polyclonal Antibody, Unconjugated from Abnova Corporation
Company Abnova Corporation
Item Mouse Anti-PPP4C Polyclonal Antibody, Unconjugated
Price 
Description Mouse polyclonal antibody raised against a partial recombinant PPP4C.
Immunogen: PPP4C (NP_002711, 218 a.a. ~ 308 a.a) partial recombinant protein with GST tag.
Accession Number: NM_002720
Protein Sequence: GSDVVAQFNAANDIDMICRAHQLVMEGYKWHFNETVLTVWSAPNYCYRCGNVAAILELDEHLQKDFIIFEAAPQETRGIPSKKPVADYFL*
Info Abnova CorporationAbnova Corporation
Abnova Corporation (HQ)
9th Fl., No. 108, Jhouzih St.
Neihu District, Taipei
114 Taiwan R.O.C.
Tel: +886-2-8751-1888
Fax: +886-2-8751-1166

Abnova GmbH
Boxbergring 107
69126 Heidelberg
Germany
Tel: +49 6221 3632226
Fax: +49 6221 825878

Customer Service: +886-2-8751-1888
Fax Number: +886-2-8751-1166
Web Site: http://www.abnova.com.tw
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Mouse Anti-Amodiaquine Monoclonal Antibody, Unconjugated, Clone 6D10 from AntibodyShop A/S
2. Mouse Anti-Protein S Monoclonal Antibody, Unconjugated, Clone HYB 232-02 from Abcam
3. Mouse Anti-Mouse Glutathione S-transferase M1 (GSTM1) Monoclonal Antibody, Unconjugated from Lifespan Biosciences
4. Mouse Anti-Human S-100 alpha/beta chain Monoclonal Antibody, Unconjugated, Clone 8B10 from Santa Cruz Biotechnology, Inc.
5. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Testis from OriGene Technologies
6. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Brain (adult) from OriGene Technologies
7. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (12.5 - day) from OriGene Technologies
8. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (19 - day) from OriGene Technologies
9. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Thymus from OriGene Technologies
10. Mouse Anti-Human Complement factor B Monoclonal Antibody, Unconjugated, Clone 9B6 from AntibodyShop A/S
11. Mouse Anti-Human Choriongonadotropin (hCG) Monoclonal Antibody, Unconjugated, Clone 5F10 from AntibodyShop A/S
ERalpha (Ser 104/106)...
... while maintaining high cell viability , ... , Fast: less than one ... , Highly reproducible results from ... with the Bio-Rad Gene Pulser Xcell System ...
Agarose, pulse field, 250 g. Nuclease-free.Gel point (1.5%): 36 1.5 C, EEO (-mr): 1800 g/cm2. Category: Nucleotides & Enzymes & Biochemicals, Ultrapure Biochemicals ....
Mouse CXCR3 Allophycocyanin MAb (Clone 220803)...
Biology Products:
(Date:3/9/2016)... March 9, 2016 Nigeria ... that more than 23,000 public service employees either did ... receiving their salary unlawfully.    --> ... identified that more than 23,000 public service employees either ... been receiving their salary unlawfully.    --> ...
(Date:3/3/2016)... Calif. , March 3, 2016  FlexTech, a ... the categories of Innovation, Research & Development, Leadership in ... Leadership. This is the 9 th year of ... group of companies and individuals from past years ... based on a pre-described set of criteria, by a ...
(Date:3/2/2016)... , March 2, 2016 ... announced the addition of the  "Global Biometrics ... their offering.  ,     (Logo: http://photos.prnewswire.com/prnh/20130307/600769) , , ... to grow at a CAGR of around ... ) has announced the addition of ...
Breaking Biology News(10 mins):
(Date:5/2/2016)... ... ... StarNet Communications Corp, ( http://www.starnet.com/ ) a leading publisher of remote Linux and ... its flagship X-Win32 PC X server. The new modules enable X-Win32 to safely ... encrypted SSH. , Traditionally, users of PC X servers deploy the XDMCP protocol to ...
(Date:4/29/2016)... , ... April 29, 2016 , ... ... personalized pain medicine, is excited to announce the launch of the Proove ... health studies, volunteerism, and education to promote the use of personalized medicine for ...
(Date:4/29/2016)... ... April 29, 2016 , ... ... to transform technology into a viable company, CereScan’s CEO, John Kelley, joined other ... a recognized leader and mentor in the Denver area business community, shared his ...
(Date:4/29/2016)... 29, 2016 Elekta is pleased ... to its industry-leading treatment planning software, is available for ... Monaco version 5.11 provides significant performance speed ... speeds up to four times faster than in previous ... industry,s gold standard Monte Carlo ...
Breaking Biology Technology: