Navigation Links
Mouse Anti-PPP4C Polyclonal Antibody, Unconjugated from Abnova Corporation

ProductsMouse Anti-PPP4C Polyclonal Antibody, Unconjugated from Abnova Corporation
Company Abnova Corporation
Item Mouse Anti-PPP4C Polyclonal Antibody, Unconjugated
Price 
Description Mouse polyclonal antibody raised against a partial recombinant PPP4C.
Immunogen: PPP4C (NP_002711, 218 a.a. ~ 308 a.a) partial recombinant protein with GST tag.
Accession Number: NM_002720
Protein Sequence: GSDVVAQFNAANDIDMICRAHQLVMEGYKWHFNETVLTVWSAPNYCYRCGNVAAILELDEHLQKDFIIFEAAPQETRGIPSKKPVADYFL*
Info Abnova CorporationAbnova Corporation
Abnova Corporation (HQ)
9th Fl., No. 108, Jhouzih St.
Neihu District, Taipei
114 Taiwan R.O.C.
Tel: +886-2-8751-1888
Fax: +886-2-8751-1166

Abnova GmbH
Boxbergring 107
69126 Heidelberg
Germany
Tel: +49 6221 3632226
Fax: +49 6221 825878

Customer Service: +886-2-8751-1888
Fax Number: +886-2-8751-1166
Web Site: http://www.abnova.com.tw
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Mouse Anti-Amodiaquine Monoclonal Antibody, Unconjugated, Clone 6D10 from AntibodyShop A/S
2. Mouse Anti-Protein S Monoclonal Antibody, Unconjugated, Clone HYB 232-02 from Abcam
3. Mouse Anti-Mouse Glutathione S-transferase M1 (GSTM1) Monoclonal Antibody, Unconjugated from Lifespan Biosciences
4. Mouse Anti-Human S-100 alpha/beta chain Monoclonal Antibody, Unconjugated, Clone 8B10 from Santa Cruz Biotechnology, Inc.
5. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Testis from OriGene Technologies
6. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Brain (adult) from OriGene Technologies
7. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (12.5 - day) from OriGene Technologies
8. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (19 - day) from OriGene Technologies
9. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Thymus from OriGene Technologies
10. Mouse Anti-Human Complement factor B Monoclonal Antibody, Unconjugated, Clone 9B6 from AntibodyShop A/S
11. Mouse Anti-Human Choriongonadotropin (hCG) Monoclonal Antibody, Unconjugated, Clone 5F10 from AntibodyShop A/S
BD IMag Anti-Mouse CD90.2 (Thy1.2) Particles-MSC 2 x 109 cells...
Antibody specific for trimethyl-Lys27 of histone H3. Mouse monoclonal. Antigen: Synthetic peptide derived from histone H3, trimethylated at lysine 27...
BD IMag Anti-Mouse CD90.2 (Thy1.2) Particles-DM 2 x 109 cells...
Chicken polyclonal to YebU ( Abpromise for all tested applications). Antigen: Synthetic peptide, corresponding to amino acids 196-244 of E. coli YebU....
Biology Products:
(Date:1/13/2017)... 13, 2017 Sandata Technologies, LLC, a ... homecare industry, including Electronic Visit Verification™ (EVV™), announced ... Jugs, as Senior Vice President of Product Management. ... of homecare experience to Sandata, where he will ... to align Sandata,s suite of solutions with the ...
(Date:1/11/2017)... 11, 2017 Intoxalock, a leading ignition interlock ... of its patent-pending calibration device. With this new technology, ... securely upload data logs and process repairs at service ... "Fighting drunk driving through the application of cutting-edge ... large, but also for the customer who can get ...
(Date:1/6/2017)... , Jan. 5, 2017  Delta ID Inc., a ... scanning technology for automotive at CES® 2017. Delta ID ... ) to demonstrate the use of iris scanning as ... authenticate the driver in a car, and as a ... driving experience. Delta ID and Gentex will ...
Breaking Biology News(10 mins):
(Date:1/24/2017)... ... January 24, 2017 , ... ... Health PRM, a chronic disease and transitions of care solution for use by ... staff to work at the top of their license. Care teams, care ...
(Date:1/24/2017)... , Jan. 24, 2017   Bracket , ... today announced the addition of Jennifer Peters ... Vice President and General Manager for the Scientific Services ... for Bracket,s work in Rater Training, Quality Assurance, and ... with a strong skillset and demonstrated record building technology-based ...
(Date:1/24/2017)... ... January 24, 2017 , ... ... and increased serum leptin levels had a positive association with increased prostate growth ... published in the International Neurourology Journal involved 571 Korean men who underwent ...
(Date:1/24/2017)... ... 2017 , ... The Foundation for Food and Agriculture Research, ... career nominees for the 2017 New Innovator in Food and Agriculture Research Award. ... in which one in nine people suffers from hunger. The Foundation for Food ...
Breaking Biology Technology: