Navigation Links
Mouse Anti-PPP4C Polyclonal Antibody, Unconjugated from Abnova Corporation

ProductsMouse Anti-PPP4C Polyclonal Antibody, Unconjugated from Abnova Corporation
Company Abnova Corporation
Item Mouse Anti-PPP4C Polyclonal Antibody, Unconjugated
Price 
Description Mouse polyclonal antibody raised against a partial recombinant PPP4C.
Immunogen: PPP4C (NP_002711, 218 a.a. ~ 308 a.a) partial recombinant protein with GST tag.
Accession Number: NM_002720
Protein Sequence: GSDVVAQFNAANDIDMICRAHQLVMEGYKWHFNETVLTVWSAPNYCYRCGNVAAILELDEHLQKDFIIFEAAPQETRGIPSKKPVADYFL*
Info Abnova CorporationAbnova Corporation
Abnova Corporation (HQ)
9th Fl., No. 108, Jhouzih St.
Neihu District, Taipei
114 Taiwan R.O.C.
Tel: +886-2-8751-1888
Fax: +886-2-8751-1166

Abnova GmbH
Boxbergring 107
69126 Heidelberg
Germany
Tel: +49 6221 3632226
Fax: +49 6221 825878

Customer Service: +886-2-8751-1888
Fax Number: +886-2-8751-1166
Web Site: http://www.abnova.com.tw
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Mouse Anti-Amodiaquine Monoclonal Antibody, Unconjugated, Clone 6D10 from AntibodyShop A/S
2. Mouse Anti-Protein S Monoclonal Antibody, Unconjugated, Clone HYB 232-02 from Abcam
3. Mouse Anti-Mouse Glutathione S-transferase M1 (GSTM1) Monoclonal Antibody, Unconjugated from Lifespan Biosciences
4. Mouse Anti-Human S-100 alpha/beta chain Monoclonal Antibody, Unconjugated, Clone 8B10 from Santa Cruz Biotechnology, Inc.
5. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Testis from OriGene Technologies
6. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Brain (adult) from OriGene Technologies
7. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (12.5 - day) from OriGene Technologies
8. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (19 - day) from OriGene Technologies
9. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Thymus from OriGene Technologies
10. Mouse Anti-Human Complement factor B Monoclonal Antibody, Unconjugated, Clone 9B6 from AntibodyShop A/S
11. Mouse Anti-Human Choriongonadotropin (hCG) Monoclonal Antibody, Unconjugated, Clone 5F10 from AntibodyShop A/S
Rabbit anti-NFkB p105/p50 (Ser529) Class: Antibody Product Group: Signalling molecules and phospho-specific Antibody...
Rabbit Anti-conjugated Agmatine Polyclonal Antibody...
... polyclonal to Taura Syndrome Virus ... for all tested applications). ... peptide: VTNSEGSTIL MNDIPITNQN VVLSKNVTDN LFEVQDQALI ... to N terminal amino acids ...
Goat polyclonal to SART3 ( Abpromise for all tested applications). Antigen: Synthetic peptide: MSNADFAKLFLRK, corresponding to C terminal amino acids 951-963 of Human SART3 Entrez Gene ID: 9...
Biology Products:
(Date:1/22/2016)... DUBLIN , January 22, 2016 ... has announced the addition of the  ... to their offering. --> ... of the  "Global Behavioral Biometric Market ... --> Research and Markets ( http://www.researchandmarkets.com/research/4lmf2s/global_behavioral ...
(Date:1/20/2016)... Jan. 20, 2016 A market that just ... benefit from the explosion in genomics knowledge. Learn all ... Research. A range of dynamic trends are pushing market ... personalized medicine - pharmacogenomics - pathogen evolution - next ... markets - greater understanding of the role of genetic ...
(Date:1/18/2016)... , Jan. 18, 2016  Extenua Inc., ... that simplifies the use and access of ubiquitous ... go-to-market partnership with American Cyber.  ... extensive experience leading transformational C4ISR and Cyber initiatives ... integrating the latest proven technology solutions," said ...
Breaking Biology News(10 mins):
(Date:2/12/2016)... ... February 12, 2016 , ... The Pittcon 2016 Exposition, which ... will include 848 exhibitors (count as of February 9) of which 119 are ... used by the scientific community in industrial, academic, and government labs. The Exposition ...
(Date:2/12/2016)... FRANCISCO , February 12, 2016 ... Medicine Efforts by Enabling Scientific Understanding of Complex ... and Rare Diseases --> ... genomic diagnostics in South Asia and a leading provider ... would contribute $10 million to the GenomeAsia 100K ...
(Date:2/11/2016)... 2016  Vermillion, Inc. (NASDAQ: VRML ), a ... the formation of the Steering Committee for its Pelvic ... --> Pelvic masses can present physicians and healthcare ... pregnancy is ruled out, pelvic masses may include cancers ... benign ovarian tumors and gastrointestinal and urinary tract masses. ...
(Date:2/11/2016)... Feb. 11, 2016  Spectra BioPharma Selling Solutions (Spectra) ... provides biopharma companies the experience, expertise, operational delivery ... outsourced sales teams. Created in concert with industry ... the strategic and tactical needs of its clients ... through both personal and non-personal promotion. ...
Breaking Biology Technology: