Navigation Links
Mouse Anti-PPP4C Polyclonal Antibody, Unconjugated from Abnova Corporation

ProductsMouse Anti-PPP4C Polyclonal Antibody, Unconjugated from Abnova Corporation
Company Abnova Corporation
Item Mouse Anti-PPP4C Polyclonal Antibody, Unconjugated
Price 
Description Mouse polyclonal antibody raised against a partial recombinant PPP4C.
Immunogen: PPP4C (NP_002711, 218 a.a. ~ 308 a.a) partial recombinant protein with GST tag.
Accession Number: NM_002720
Protein Sequence: GSDVVAQFNAANDIDMICRAHQLVMEGYKWHFNETVLTVWSAPNYCYRCGNVAAILELDEHLQKDFIIFEAAPQETRGIPSKKPVADYFL*
Info Abnova CorporationAbnova Corporation
Abnova Corporation (HQ)
9th Fl., No. 108, Jhouzih St.
Neihu District, Taipei
114 Taiwan R.O.C.
Tel: +886-2-8751-1888
Fax: +886-2-8751-1166

Abnova GmbH
Boxbergring 107
69126 Heidelberg
Germany
Tel: +49 6221 3632226
Fax: +49 6221 825878

Customer Service: +886-2-8751-1888
Fax Number: +886-2-8751-1166
Web Site: http://www.abnova.com.tw
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Mouse Anti-Amodiaquine Monoclonal Antibody, Unconjugated, Clone 6D10 from AntibodyShop A/S
2. Mouse Anti-Protein S Monoclonal Antibody, Unconjugated, Clone HYB 232-02 from Abcam
3. Mouse Anti-Mouse Glutathione S-transferase M1 (GSTM1) Monoclonal Antibody, Unconjugated from Lifespan Biosciences
4. Mouse Anti-Human S-100 alpha/beta chain Monoclonal Antibody, Unconjugated, Clone 8B10 from Santa Cruz Biotechnology, Inc.
5. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Testis from OriGene Technologies
6. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Brain (adult) from OriGene Technologies
7. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (12.5 - day) from OriGene Technologies
8. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (19 - day) from OriGene Technologies
9. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Thymus from OriGene Technologies
10. Mouse Anti-Human Complement factor B Monoclonal Antibody, Unconjugated, Clone 9B6 from AntibodyShop A/S
11. Mouse Anti-Human Choriongonadotropin (hCG) Monoclonal Antibody, Unconjugated, Clone 5F10 from AntibodyShop A/S
... suspension array system, 100-240 V, uses xMAP ... to 100 proteins and peptides in one ... of up to 100 color-coded bead sets, ... a unique reactant (enzyme substrates, receptors, antigens, ...
... The high-throughput fluidics (HTF) system, 100-240 V, ... suspension array system that automates delivery of ... into the Bio-Plex array reader. The HTF ... nonpressurized bulk sheath container to constantly maintain ...
... PYREX Delong style shaker flasks have three ... agitation of solutions to improve oxygen or ... reciprocating shakers. The long neck reduces splashing ... Their uniform wall thickness provides the proper ...
... gradient system uses two Adept CE 4100 ... CE 4200 dual wavelength detector for added flexibility. ... by PowerStream data processing software and interface unit, ... The supplied analytical pumps may be substituted ...
Biology Products:
(Date:10/15/2014)... PORT WASHINGTON, N.Y. , Oct. 15, 2014 ... in technology solutions for home and community-based care, ... the benefits of implementing Sandata,s Santrax® Electronic Visit ... Quality Care Services is a home health company ... Texas . ...
(Date:10/15/2014)... The German Gauß-Allianz has admitted Johannes Gutenberg University ... the Rhineland-Palatinate science hub continues to maintain a ... computing. , "The acceptance of Johannes Gutenberg ... Gauß-Allianz is a milestone in the national and ... support. The state of Rhineland-Palatinate can be proud ...
(Date:10/15/2014)... Conn. , Oct. 15, 2014 NXT-ID, Inc. (NASDAQ: ... biometric authentication company focused on the growing mobile commerce market releases ... MarketSite in Times Square on Monday October 13 th . ... CTO David Tunnel and angel investor Mr. Chad ... Pereira , CEO of NXT-ID thanked his investors and employees "for ...
Breaking Biology News(10 mins):Sandata Announces Case Study with Quality Care Services, Inc. 2Johannes Gutenberg University Mainz joins Germany's Gauss-Allianz as a full member 2Johannes Gutenberg University Mainz joins Germany's Gauss-Allianz as a full member 3Photo Release: NXT-ID Inc. Rings Opening Bell of the NASDAQ Stock Market October 13th 2Photo Release: NXT-ID Inc. Rings Opening Bell of the NASDAQ Stock Market October 13th 3
... of the Walter and Eliza Hall Institute of Medical ... of the 2009 Pearl Meister Greengard Prize. ... the accomplishments of outstanding female scientists, at The Rockefeller ... prize was founded by Rockefeller Nobel laureate Paul Greengard ...
... highlands split and the Great Rift Valley formed, the ... different atmospheric circulation patterns than it does today, according ... central African nation. Neil J. Tabor, associate professor ... and an expert in sedimentology and isotope geochemistry, calculated ...
... over could benefit from new software* created at the National ... scientists has found a way to improve the efficiency of ... Alabama at Birmingham (UAB). Pneumonia is the world,s leading ... and poses a serious risk to elderly adults. The leading ...
Cached Biology News:Professor Suzanne Cory awarded 2009 Pearl Meister Greengard Prize 2Ethiopia's climate 27 million years ago had higher rainfall, warmer soil 2Scientists create NICE solution to pneumonia vaccine testing problems 2
(Date:10/20/2014)... , Oct. 20, 2014  GenVec, Inc. (NASDAQ: ... P. Horovitz , Ph.D., from its board of directors effective ... in August 2003, and served as its chairman from June ... on the Nominating and Corporate Governance and Audit Committees of ... more than a decade of dedicated service to GenVec, and ...
(Date:10/20/2014)... 20, 2014 Earle Martin ... announced today that Ellen Teplitzky, an experienced attorney ... the pharmaceutical industry, has joined the firm as ... legal services practice. NDA Partners provides legal ... and testimony, to top law firms and their ...
(Date:10/19/2014)... 20, 2014 OCTOBER 20-22, ... (ABIM). ABIM will take place at ... about ABIM 2014 is now available at ... representing companies and organizations from all over ... information on the latest products and developments ...
(Date:10/19/2014)... 2014 The Asian Automatic patient billing ... analysis and forecast of revenue. The Automatic patient billing ... $463.9 million by 2018, at a developing CAGR of ... TOC of the Asian Automatic patient billing market, to ... also provides a glimpse of the segmentation of this ...
Breaking Biology Technology:Zola P. Horovitz To Retire From GenVec Board 2NDA Partners Appoints Ellen Teplitzky, JD as Director of its Legal Services Practice 2The Asian Automatic patient billing market is estimated to grow to around $463.9 million by 2018 - New Report by MicroMarket Monitor 2The Asian Automatic patient billing market is estimated to grow to around $463.9 million by 2018 - New Report by MicroMarket Monitor 3