Navigation Links
Mouse Anti-PPP4C Polyclonal Antibody, Unconjugated from Abnova Corporation

ProductsMouse Anti-PPP4C Polyclonal Antibody, Unconjugated from Abnova Corporation
Company Abnova Corporation
Item Mouse Anti-PPP4C Polyclonal Antibody, Unconjugated
Price 
Description Mouse polyclonal antibody raised against a partial recombinant PPP4C.
Immunogen: PPP4C (NP_002711, 218 a.a. ~ 308 a.a) partial recombinant protein with GST tag.
Accession Number: NM_002720
Protein Sequence: GSDVVAQFNAANDIDMICRAHQLVMEGYKWHFNETVLTVWSAPNYCYRCGNVAAILELDEHLQKDFIIFEAAPQETRGIPSKKPVADYFL*
Info Abnova CorporationAbnova Corporation
Abnova Corporation (HQ)
9th Fl., No. 108, Jhouzih St.
Neihu District, Taipei
114 Taiwan R.O.C.
Tel: +886-2-8751-1888
Fax: +886-2-8751-1166

Abnova GmbH
Boxbergring 107
69126 Heidelberg
Germany
Tel: +49 6221 3632226
Fax: +49 6221 825878

Customer Service: +886-2-8751-1888
Fax Number: +886-2-8751-1166
Web Site: http://www.abnova.com.tw
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Mouse Anti-Amodiaquine Monoclonal Antibody, Unconjugated, Clone 6D10 from AntibodyShop A/S
2. Mouse Anti-Protein S Monoclonal Antibody, Unconjugated, Clone HYB 232-02 from Abcam
3. Mouse Anti-Mouse Glutathione S-transferase M1 (GSTM1) Monoclonal Antibody, Unconjugated from Lifespan Biosciences
4. Mouse Anti-Human S-100 alpha/beta chain Monoclonal Antibody, Unconjugated, Clone 8B10 from Santa Cruz Biotechnology, Inc.
5. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Testis from OriGene Technologies
6. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Brain (adult) from OriGene Technologies
7. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (12.5 - day) from OriGene Technologies
8. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (19 - day) from OriGene Technologies
9. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Thymus from OriGene Technologies
10. Mouse Anti-Human Complement factor B Monoclonal Antibody, Unconjugated, Clone 9B6 from AntibodyShop A/S
11. Mouse Anti-Human Choriongonadotropin (hCG) Monoclonal Antibody, Unconjugated, Clone 5F10 from AntibodyShop A/S
Human Serum FDA Licensed US Donor Centers Sterile / Non-sterile: Sterile Filtered to 0.2 micron Information: Extensive Viral Testing ...
Normal human serum collected off the clot from healthy normal humans. Each donor unit is negative for anti-HIV 1&2, HIV-Ag, HCV, and HBsAg by FDA required tests...
One-step, colorimetric, linear detection range 0.7 mg/dL to 300 mg/dL. Procedure: 10 min....
XBP1 Antibody...
Biology Products:
(Date:12/6/2016)... DALLAS , Dec. 6, 2016 ... criminal justice technology solutions for public safety, investigation, ... (PEP) jointly announced today a five (5) year ... exclusive agreement to expand the rehabilitation and reentry ... PEP History Established in 2004, the Prison ...
(Date:11/30/2016)... , Nov. 30, 2016 Not many of us realize that we ... of recovery so we need to do it well. Inadequate sleep levels have been ... blood pressure, stroke, diabetes, and even cancer. Maybe now is the best ... that could help them to manage their sleep quality? ... ...
(Date:11/29/2016)... Nearly one billion matches per second with DERMALOG,s high-speed AFIS    ... ... DERMALOG is Germany's largest Multi-Biometric supplier: The ... Identification Systems) ... Germany's largest Multi-Biometric supplier: The company's Fingerprint Identification System is part of ...
Breaking Biology News(10 mins):
(Date:12/9/2016)... ... December 09, 2016 , ... DuPont Industrial Biosciences ... the Breakthrough Solution of the Year Award from Platts Global Energy for ... The award was announced at the 18th Platts Global Energy Awards, held in ...
(Date:12/9/2016)... ALBANY, New York , December 9, 2016 /PRNewswire/ ... Research states that the top five players in the  ... of 62.7% in the overall market in 2015. Players ... and Perkin Elmer have remained dominant in the global ... persistent efforts to ensure product innovation. Product upgrades and ...
(Date:12/9/2016)... Dec. 9, 2016 China Cord Blood Corporation (NYSE: ... China,s leading provider of cord blood collection, laboratory ... today announced the results of its 2016 Annual General Meeting, ... S.A.R., China . At ... the re-appointment of KPMG Huazhen LLP as the independent auditors ...
(Date:12/9/2016)... India , December 9, 2016 According ... & Services (Primer, Probe, Custom, Predesigned, Reagent Equipment), Application (Research, PCR, ... Forecasts to 2021" published by MarketsandMarkets, the global market is expected ... in 2016, at a CAGR of 10.6% during the forecast period. ... ...
Breaking Biology Technology: