Navigation Links
Mouse Anti-PPP4C Polyclonal Antibody, Unconjugated from Abnova Corporation

ProductsMouse Anti-PPP4C Polyclonal Antibody, Unconjugated from Abnova Corporation
Company Abnova Corporation
Item Mouse Anti-PPP4C Polyclonal Antibody, Unconjugated
Price 
Description Mouse polyclonal antibody raised against a partial recombinant PPP4C.
Immunogen: PPP4C (NP_002711, 218 a.a. ~ 308 a.a) partial recombinant protein with GST tag.
Accession Number: NM_002720
Protein Sequence: GSDVVAQFNAANDIDMICRAHQLVMEGYKWHFNETVLTVWSAPNYCYRCGNVAAILELDEHLQKDFIIFEAAPQETRGIPSKKPVADYFL*
Info Abnova CorporationAbnova Corporation
Abnova Corporation (HQ)
9th Fl., No. 108, Jhouzih St.
Neihu District, Taipei
114 Taiwan R.O.C.
Tel: +886-2-8751-1888
Fax: +886-2-8751-1166

Abnova GmbH
Boxbergring 107
69126 Heidelberg
Germany
Tel: +49 6221 3632226
Fax: +49 6221 825878

Customer Service: +886-2-8751-1888
Fax Number: +886-2-8751-1166
Web Site: http://www.abnova.com.tw
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Mouse Anti-Amodiaquine Monoclonal Antibody, Unconjugated, Clone 6D10 from AntibodyShop A/S
2. Mouse Anti-Protein S Monoclonal Antibody, Unconjugated, Clone HYB 232-02 from Abcam
3. Mouse Anti-Mouse Glutathione S-transferase M1 (GSTM1) Monoclonal Antibody, Unconjugated from Lifespan Biosciences
4. Mouse Anti-Human S-100 alpha/beta chain Monoclonal Antibody, Unconjugated, Clone 8B10 from Santa Cruz Biotechnology, Inc.
5. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Testis from OriGene Technologies
6. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Brain (adult) from OriGene Technologies
7. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (12.5 - day) from OriGene Technologies
8. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (19 - day) from OriGene Technologies
9. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Thymus from OriGene Technologies
10. Mouse Anti-Human Complement factor B Monoclonal Antibody, Unconjugated, Clone 9B6 from AntibodyShop A/S
11. Mouse Anti-Human Choriongonadotropin (hCG) Monoclonal Antibody, Unconjugated, Clone 5F10 from AntibodyShop A/S
... Freedom EVO series offers versatile liquid handling ... automate a wide variety of life science ... different base sizes (75, 100, 150 and ... to a platform that will advance with ...
... This product has been developed to ... peroxidase labeled proteins. Stability is increased ... to 2-8 centigrade. This product is ... no mercury or azide. This formulation ...
... convenient and affordable alternative for diagnostic assays ... eight-port disposable manifold, the StatMatic I provides ... The eight-port manifold, designed for 96-well microplates, ... 250, or 300mL with well-to-well accuracy of ...
...
Biology Products:
(Date:3/24/2017)... 2017 Research and Markets has announced the ... & Trends - Industry Forecast to 2025" report to their ... The Global ... CAGR of around 15.1% over the next decade to reach approximately ... the market estimates and forecasts for all the given segments on ...
(Date:3/23/2017)... Research and Markets has announced the addition ... - Industry Forecast to 2025" report to their offering. ... The Global Vehicle ... around 8.8% over the next decade to reach approximately $14.21 billion ... estimates and forecasts for all the given segments on global as ...
(Date:3/22/2017)... 21, 2017 Optimove , provider ... retailers such as 1-800-Flowers and AdoreMe, today announced ... and Replenishment. Using Optimove,s machine learning algorithms, these ... and replenishment recommendations to their customers based not ... of customer intent drawn from a complex web ...
Breaking Biology News(10 mins):
(Date:6/19/2017)... (PRWEB) , ... June 19, 2017 , ... A colony ... among its cells and tissues by delivering pollen and nectar containing nutrients necessary for ... means to stay healthy. , Many recent indicators point to a decline in honey ...
(Date:6/16/2017)... ... June 16, 2017 , ... Cambridge ... announced that its Anzo Smart Data Lake® (Anzo SDL) solution was named ... the 2017 Software & Information Industry Association (SIIA) CODiE Awards. , Finalists ...
(Date:6/15/2017)... ... June 15, 2017 , ... New resistant soybean ... options for managing Palmer amaranth and other broadleaf weeds resistant to glyphosate. But ... necessary. Auxin herbicides are known to drift and to cause harm to sensitive, ...
(Date:6/15/2017)... ... June 15, 2017 , ... ... (EKG) follows an artist’s journey through creative experimentation and interdisciplinary collaboration. Feature Creep, ... through July 22nd. An opening reception will be held at EKG, located at ...
Breaking Biology Technology: