Navigation Links
Mouse Anti-PPP4C Polyclonal Antibody, Unconjugated from Abnova Corporation

ProductsMouse Anti-PPP4C Polyclonal Antibody, Unconjugated from Abnova Corporation
Company Abnova Corporation
Item Mouse Anti-PPP4C Polyclonal Antibody, Unconjugated
Price 
Description Mouse polyclonal antibody raised against a partial recombinant PPP4C.
Immunogen: PPP4C (NP_002711, 218 a.a. ~ 308 a.a) partial recombinant protein with GST tag.
Accession Number: NM_002720
Protein Sequence: GSDVVAQFNAANDIDMICRAHQLVMEGYKWHFNETVLTVWSAPNYCYRCGNVAAILELDEHLQKDFIIFEAAPQETRGIPSKKPVADYFL*
Info Abnova CorporationAbnova Corporation
Abnova Corporation (HQ)
9th Fl., No. 108, Jhouzih St.
Neihu District, Taipei
114 Taiwan R.O.C.
Tel: +886-2-8751-1888
Fax: +886-2-8751-1166

Abnova GmbH
Boxbergring 107
69126 Heidelberg
Germany
Tel: +49 6221 3632226
Fax: +49 6221 825878

Customer Service: +886-2-8751-1888
Fax Number: +886-2-8751-1166
Web Site: http://www.abnova.com.tw
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Mouse Anti-Amodiaquine Monoclonal Antibody, Unconjugated, Clone 6D10 from AntibodyShop A/S
2. Mouse Anti-Protein S Monoclonal Antibody, Unconjugated, Clone HYB 232-02 from Abcam
3. Mouse Anti-Mouse Glutathione S-transferase M1 (GSTM1) Monoclonal Antibody, Unconjugated from Lifespan Biosciences
4. Mouse Anti-Human S-100 alpha/beta chain Monoclonal Antibody, Unconjugated, Clone 8B10 from Santa Cruz Biotechnology, Inc.
5. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Testis from OriGene Technologies
6. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Brain (adult) from OriGene Technologies
7. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (12.5 - day) from OriGene Technologies
8. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (19 - day) from OriGene Technologies
9. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Thymus from OriGene Technologies
10. Mouse Anti-Human Complement factor B Monoclonal Antibody, Unconjugated, Clone 9B6 from AntibodyShop A/S
11. Mouse Anti-Human Choriongonadotropin (hCG) Monoclonal Antibody, Unconjugated, Clone 5F10 from AntibodyShop A/S
Goat polyclonal to SART3 ( Abpromise for all tested applications). Antigen: Synthetic peptide: MSNADFAKLFLRK, corresponding to C terminal amino acids 951-963 of Human SART3 Entrez Gene ID: 9...
JAB1 Immunogen: Synthetic peptide, conjugated to KLH, corresponding to residues S(201) E Y Q T I P L N K I E D F G V(216) of human JAB1. The sequence is identical in mouse and rat. Storage: -...
Hamartin/TSC1 (1B2) Mouse mAb Ship: Hot Store: -20 C...
Blank Calibration Particles, 3.0-3.4 mu m 5 ml...
Biology Products:
(Date:3/22/2017)... 21, 2017 Vigilant Solutions , a ... enforcement agencies, announced today the appointment of retired FBI ... public safety business development. Mr. Sheridan brings ... including a focus on the aviation transportation sector, to ... position, Mr. Sheridan served as the Aviation Liaison Agent ...
(Date:3/9/2017)... , Australia , March 9, ... study data at the prestigious World Lung Imaging Workshop ... Andreas Fouras , was invited to deliver the ... pulmonary medicine. This globally recognised event brings together leaders ... share the latest developments in lung imaging. ...
(Date:3/2/2017)... YORK , March 2, 2017 Summary ... better understand Perrigo and its partnering interests and activities since ... ... Partnering Deals and Alliance since 2010 report provides an in-depth ... leading life sciences companies. On demand company reports ...
Breaking Biology News(10 mins):
(Date:3/24/2017)... -- On Thursday, March 23, 2017, the ... 0.07%; the Dow Jones Industrial Average edged 0.02% lower, ... at 2,345.96, marginally dropping 0.11%. US markets saw a ... sectors finished in red, and 1 sector ended flat ... coverage on the following Biotechnology equities: BioDelivery Sciences International ...
(Date:3/23/2017)... Research and Markets has announced the addition of ... offering. ... The Global Market for Bioproducts Should Reach $714.6 Billion ... of 8.9%, This research report quantifies the ... product segments: bio-derived chemicals, biofuels, pharmaceuticals (biodrugs and herbal/botanicals), biocomposite ...
(Date:3/23/2017)... ... 23, 2017 , ... Ellen Matloff, president and CEO of ... as a 2017 Women of Innovation® finalist. Matloff will be among several women ... The dinner recognizes women accomplished in science, technology, engineering and math (STEM), along ...
(Date:3/23/2017)... 2017 In today,s pre-market research, ... the Biotech industry: Sangamo Therapeutics Inc. (NASDAQ: SGMO), Eyegate ... SYN), and Regulus Therapeutics Inc. (NASDAQ: RGLS ... Suisse upgraded its rating on Pharmaceuticals/Biotechnology to "Overweight" from "Market Weight." Learn ... at: ...
Breaking Biology Technology: