Navigation Links
Mouse Anti-PPP4C Polyclonal Antibody, Unconjugated from Abnova Corporation

ProductsMouse Anti-PPP4C Polyclonal Antibody, Unconjugated from Abnova Corporation
Company Abnova Corporation
Item Mouse Anti-PPP4C Polyclonal Antibody, Unconjugated
Price 
Description Mouse polyclonal antibody raised against a partial recombinant PPP4C.
Immunogen: PPP4C (NP_002711, 218 a.a. ~ 308 a.a) partial recombinant protein with GST tag.
Accession Number: NM_002720
Protein Sequence: GSDVVAQFNAANDIDMICRAHQLVMEGYKWHFNETVLTVWSAPNYCYRCGNVAAILELDEHLQKDFIIFEAAPQETRGIPSKKPVADYFL*
Info Abnova CorporationAbnova Corporation
Abnova Corporation (HQ)
9th Fl., No. 108, Jhouzih St.
Neihu District, Taipei
114 Taiwan R.O.C.
Tel: +886-2-8751-1888
Fax: +886-2-8751-1166

Abnova GmbH
Boxbergring 107
69126 Heidelberg
Germany
Tel: +49 6221 3632226
Fax: +49 6221 825878

Customer Service: +886-2-8751-1888
Fax Number: +886-2-8751-1166
Web Site: http://www.abnova.com.tw
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Mouse Anti-Amodiaquine Monoclonal Antibody, Unconjugated, Clone 6D10 from AntibodyShop A/S
2. Mouse Anti-Protein S Monoclonal Antibody, Unconjugated, Clone HYB 232-02 from Abcam
3. Mouse Anti-Mouse Glutathione S-transferase M1 (GSTM1) Monoclonal Antibody, Unconjugated from Lifespan Biosciences
4. Mouse Anti-Human S-100 alpha/beta chain Monoclonal Antibody, Unconjugated, Clone 8B10 from Santa Cruz Biotechnology, Inc.
5. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Testis from OriGene Technologies
6. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Brain (adult) from OriGene Technologies
7. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (12.5 - day) from OriGene Technologies
8. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (19 - day) from OriGene Technologies
9. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Thymus from OriGene Technologies
10. Mouse Anti-Human Complement factor B Monoclonal Antibody, Unconjugated, Clone 9B6 from AntibodyShop A/S
11. Mouse Anti-Human Choriongonadotropin (hCG) Monoclonal Antibody, Unconjugated, Clone 5F10 from AntibodyShop A/S
... protein assay reagents package is used for determining ... and detergents. The RC DC protein assay is ... for 500 standard assays: 250 ml RC reagent ... alkaline copper tartrate solution, 2 L dilute Folin ...
... SureLINK Bioconjugation Kit provides a powerful ... carbohydrates and nuceleic acids. The kit provides ... with reagents for quantifying conjugation efficiencies. It ... fluorophores, biotin and other tags with a ...
...
MAb to HLA, Class II-DR+DP Dry Ice: No Preservative: NaN3 Availability When Not in Inventory: 14-21 Business Days...
Biology Products:
(Date:7/11/2014)... Recent evidence has demonstrated that transplantation of mesenchymal stem ... rat or mouse models of Alzheimer,s disease (AD) and ... cerebral ischemia. Few studies are reported on the therapeutic ... with AD and on the effect on oxidative injury ... Yufang Yan and her team, School of Life Sciences, ...
(Date:7/11/2014)... 1 can inhibit voltage-gated calcium channel, decrease ... However, some scholars demonstrated that cannabinoid receptor ... and increase neurotransmitter release. Dr. Yi Zhang ... Tongji Medical College, Huazhong University of Science ... and calcium imaging in cultured trigeminal ganglion ...
(Date:7/11/2014)... Rio de Janeiro, Brazil- In the brains of ... mechanism that allows an electric or chemical signal ... another. Chemical synapses, which are the most abundant ... inhibitory. Synapse formation is crucial for learning, memory, ... and inhibitory synapses critical for brain function. ...
Breaking Biology News(10 mins):Blame it on the astrocytes 2
... Nov. 14, 2013  Inovio Pharmaceuticals, Inc. (NYSE MKT: INO) ... J. Joseph Kim , has been selected to receive ... from the Korean American Society in Biotech and Pharmaceuticals ... of drug discovery and development through collaborations and information ...
... which fills in a significant gap in the fossil record ... today. A skull from the new species, named Panthera ... Jack Tseng a PhD student at the USC Dornsife College ... and now a postdoctoral fellow at the American Museum of Natural ...
... UC San Diego and their colleagues are unraveling the ... dazzling bioluminescent display in the form of puffs of ... world in muddy environments, from shallow bays to deeper ... marine wormcommonly known as the "parchment tube worm" due ...
Cached Biology News:Inovio Pharmaceuticals CEO Receives 2013 Drug Discovery & Achievement Award 2Inovio Pharmaceuticals CEO Receives 2013 Drug Discovery & Achievement Award 3Inovio Pharmaceuticals CEO Receives 2013 Drug Discovery & Achievement Award 4Inovio Pharmaceuticals CEO Receives 2013 Drug Discovery & Achievement Award 5Fossil of new big cat species discovered; oldest ever found 2Nature's glowing slime: Scientists peek into hidden sea worm's light 2Nature's glowing slime: Scientists peek into hidden sea worm's light 3
(Date:7/10/2014)... -- Kainos Capital, a firm specializing in acquiring and managing ... acquired the Slim-Fast brand from Unilever. Unilever will retain ... transaction were not disclosed. Slim-Fast is a ... ready-to-drink shakes, powders, bars and snacks to retail customers ... the United Kingdom and Ireland.  ...
(Date:7/10/2014)... , July 10, 2014 Research and ... of the "International Photonic Integrated Circuit (Monolithic ... to 2019" report to their offering. ... The concept of photonic integration traces its roots ... The promise of photonic integration went unexplored and ...
(Date:7/10/2014)... -- According to the International Atomic Energy Agency ... from terrorists acquiring sufficient quantities of plutonium or ... nuclear explosive device. The IAEA also notes that ... gram-level quantities, which can be challenging to detect ... new study appearing this week in the ...
(Date:7/10/2014)... 17, 2014 Using microscopic polymer light resonators ... researchers at MIT,s Quantum Photonics Laboratory have developed ... the parts-per-billion range. Optical sensors are ideal for ... signal-to-noise ratio, compact, lightweight nature, and immunity to ... had been developed before, the MIT team conceived ...
Breaking Biology Technology:Kainos Capital Acquires Slim-Fast From Unilever 2International Photonic Integrated Circuit (Monolithic Integration, Hybrid Integration, Module Integration) Market - Forecasts to 2019 2Sensitive detection method may help impede illicit nuclear trafficking 2Swell new sensors 2