Navigation Links
Mouse Anti-PPP4C Polyclonal Antibody, Unconjugated from Abnova Corporation

ProductsMouse Anti-PPP4C Polyclonal Antibody, Unconjugated from Abnova Corporation
Company Abnova Corporation
Item Mouse Anti-PPP4C Polyclonal Antibody, Unconjugated
Price 
Description Mouse polyclonal antibody raised against a partial recombinant PPP4C.
Immunogen: PPP4C (NP_002711, 218 a.a. ~ 308 a.a) partial recombinant protein with GST tag.
Accession Number: NM_002720
Protein Sequence: GSDVVAQFNAANDIDMICRAHQLVMEGYKWHFNETVLTVWSAPNYCYRCGNVAAILELDEHLQKDFIIFEAAPQETRGIPSKKPVADYFL*
Info Abnova CorporationAbnova Corporation
Abnova Corporation (HQ)
9th Fl., No. 108, Jhouzih St.
Neihu District, Taipei
114 Taiwan R.O.C.
Tel: +886-2-8751-1888
Fax: +886-2-8751-1166

Abnova GmbH
Boxbergring 107
69126 Heidelberg
Germany
Tel: +49 6221 3632226
Fax: +49 6221 825878

Customer Service: +886-2-8751-1888
Fax Number: +886-2-8751-1166
Web Site: http://www.abnova.com.tw
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Mouse Anti-Amodiaquine Monoclonal Antibody, Unconjugated, Clone 6D10 from AntibodyShop A/S
2. Mouse Anti-Protein S Monoclonal Antibody, Unconjugated, Clone HYB 232-02 from Abcam
3. Mouse Anti-Mouse Glutathione S-transferase M1 (GSTM1) Monoclonal Antibody, Unconjugated from Lifespan Biosciences
4. Mouse Anti-Human S-100 alpha/beta chain Monoclonal Antibody, Unconjugated, Clone 8B10 from Santa Cruz Biotechnology, Inc.
5. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Testis from OriGene Technologies
6. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Brain (adult) from OriGene Technologies
7. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (12.5 - day) from OriGene Technologies
8. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (19 - day) from OriGene Technologies
9. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Thymus from OriGene Technologies
10. Mouse Anti-Human Complement factor B Monoclonal Antibody, Unconjugated, Clone 9B6 from AntibodyShop A/S
11. Mouse Anti-Human Choriongonadotropin (hCG) Monoclonal Antibody, Unconjugated, Clone 5F10 from AntibodyShop A/S
... and reliable automation for today's drug ... laboratories. Staccato Mini-Workstations offer the minimal ... liquid handling and material management tasks. ... Caliper's time proven CLARA™ assay development ...
Caliper offers a wide array of standard LabChip products designed to be used in combination with our AMS 90 and LabChip 3000 microfluidic platforms....
... high experimental throughput, minimum input of ... 4 up to 16 culture vessels ... users with proven fermentation results when ... fungi or any other microbial application. ...
Experion HighSens chips are the microfluidic chips used to perform high-sensitivity RNA analysis (picogram levels) with the Experion automated electrophoresis system. Each chip has the capacity to ru...
Biology Products:
(Date:9/19/2014)... of fairness did not evolve for the sake of ... benefits of continued cooperation, so say Frans de Waal, ... article about inequity aversion (IA), which is defined as ... published in Science . , Their conclusion ... studies to address their hypothesis that it is the ...
(Date:9/19/2014)... Sept. 19, 2014 Nxt-ID, Inc. (Nasdaq: NXTD ... focused on the growing m-commerce market, updates the "Wocket in Your ... the lightweight and light middleweight weight classes, Vinny Pazienza ... announced that Game of Thrones actor Ciaran Hinds ... Children star Katey Sagal have been cast in ...
(Date:9/18/2014)... - Washington State University researchers have developed a unique ... power waste cleanup in rural areas. , The ... an inexpensive and quick way to clean up waste ... while reducing pollution. , Professor Haluk Beyenal and ... Engineering and Architecture discuss the system in the online ...
Breaking Biology News(10 mins):Evolution of responses to (un)fairness 2Evolution of responses to (un)fairness 3NXT-ID's Vinny Paz Celebrity Ad Wocket Update: Katey Sagal and Ciaran Hinds Attached to His Upcoming Movie 2NXT-ID's Vinny Paz Celebrity Ad Wocket Update: Katey Sagal and Ciaran Hinds Attached to His Upcoming Movie 3Researchers develop unique waste cleanup for rural areas 2
... MADISON, Wis. Certain lichens can break down the ... neurological disease fatal to wild deer and elk and spreading ... Survey research published today in the journal PLoS ONE ... by unusual, infectious proteins called prions. One of the best-known ...
... in an advance online publication in Nature Genetics ... which, combined with other approaches, may explain 40 to 50 ... a few years, proposes the study,s lead investigator. This approach, ... will potentially allow clinicians to "lift the hood on what ...
... HILL, MA (5/18/2011) Carbon found within ancient rocks has ... emergence of biological life on the planet billions of years ... from northern Canada has revealed the carbon-based minerals may be ... researchers report in the latest edition of the journal ...
Cached Biology News:Lichens may aid in combating deadly chronic wasting disease in wildlife 2New technique promises to 'lift the hood’ on autism 2New technique promises to 'lift the hood’ on autism 3New technique promises to 'lift the hood’ on autism 4Young graphite in old rocks challenges the earliest signs of life 2
(Date:9/22/2014)... , Sept. 22, 2014 Research and ... "Global and Chinese Microcrystalline Cellulose Industry Report 2014" ... and Chinese Microcrystalline Cellulose Industry Report 2014 is a ... the global microcrystalline cellulose industry with a focus on ... basic overview of the industry including definitions, classifications, applications ...
(Date:9/22/2014)... TORONTO , Sept. 22, 2014 ... (OTCBB:GNBT) today announced that it has entered into ... to which UHN,s Centre for Molecular Design and ... refinement project.  The goal of the project is ... the Company,s proprietary buccal insulin spray product, thereby ...
(Date:9/22/2014)... Washington, D.C (PRWEB) September 22, 2014 ... the top privately held biotechnology companies of 2014. ... of companies before selecting this year’s winners. Those ... private biotechnology companies in the industry. , ... a new group of Fierce 15 companies," said Carroll. ...
(Date:9/22/2014)... The US markets on Friday, September 19, ... Jones Industrial Average finished at 17,279.74, up 0.08% and ... S&P 500 finished the session 0.05% lower at 2,010.40. ... finished on a positive note. The S&P 500 Health ... 0.10%, with the index gaining 6.95% in the previous ...
Breaking Biology Technology:Global and Chinese Microcrystalline Cellulose Industry Report 2014 2Generex Collaborates with University Health Network for Buccal Insulin Project 2Generex Collaborates with University Health Network for Buccal Insulin Project 3Generex Collaborates with University Health Network for Buccal Insulin Project 4FierceBiotech Announces Annual “Fierce 15” Winners of 2014 2Stock Updates on Biotech Industry - Array BioPharma, Enzon Pharma, Alkermes, Amarin, and Synergy Pharma 2Stock Updates on Biotech Industry - Array BioPharma, Enzon Pharma, Alkermes, Amarin, and Synergy Pharma 3Stock Updates on Biotech Industry - Array BioPharma, Enzon Pharma, Alkermes, Amarin, and Synergy Pharma 4Stock Updates on Biotech Industry - Array BioPharma, Enzon Pharma, Alkermes, Amarin, and Synergy Pharma 5