Navigation Links
Mouse Anti-NFKBIB Monoclonal Antibody, Unconjugated, Clone 2B11 from Abnova Corporation

ProductsMouse Anti-NFKBIB Monoclonal Antibody, Unconjugated, Clone 2B11 from Abnova Corporation
Company Abnova Corporation
Item Mouse Anti-NFKBIB Monoclonal Antibody, Unconjugated, Clone 2B11
Price 
Description Mouse monoclonal antibody raised against a partial recombinant NFKBIB.
Immunogen: NFKBIB (AAH15528, 56 a.a. ~ 145 a.a) partial recombinant protein with GST tag.
Protein Sequence: EDGDTALHLAVIHQHEPFLDFLLGFSAGTEYMDLQNDLGQTALHLAAILGETSTVEKLYAAGAGLCVAERRGHTALHLACRVGAHACARA
Accession: BC015528
Protein Accession Number: AAH15528
OMIM: 604495,
GeneID: 4793
Lot Number: MM951100683
MA Code: ABVAP92OG
Operation Date: 2006/12/22
Info Abnova CorporationAbnova Corporation
Abnova Corporation (HQ)
9th Fl., No. 108, Jhouzih St.
Neihu District, Taipei
114 Taiwan R.O.C.
Tel: +886-2-8751-1888
Fax: +886-2-8751-1166

Abnova GmbH
Boxbergring 107
69126 Heidelberg
Germany
Tel: +49 6221 3632226
Fax: +49 6221 825878

Customer Service: +886-2-8751-1888
Fax Number: +886-2-8751-1166
Web Site: http://www.abnova.com.tw
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Mouse Anti-Amodiaquine Monoclonal Antibody, Unconjugated, Clone 6D10 from AntibodyShop A/S
2. Mouse Anti-Protein S Monoclonal Antibody, Unconjugated, Clone HYB 232-02 from Abcam
3. Mouse Anti-Mouse Glutathione S-transferase M1 (GSTM1) Monoclonal Antibody, Unconjugated from Lifespan Biosciences
4. Mouse Anti-Human S-100 alpha/beta chain Monoclonal Antibody, Unconjugated, Clone 8B10 from Santa Cruz Biotechnology, Inc.
5. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Testis from OriGene Technologies
6. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Brain (adult) from OriGene Technologies
7. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (12.5 - day) from OriGene Technologies
8. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (19 - day) from OriGene Technologies
9. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Thymus from OriGene Technologies
10. Mouse Anti-Human Complement factor B Monoclonal Antibody, Unconjugated, Clone 9B6 from AntibodyShop A/S
11. Mouse Anti-Human Choriongonadotropin (hCG) Monoclonal Antibody, Unconjugated, Clone 5F10 from AntibodyShop A/S
... The KingFisher magnetic particle based purification ... and DNA/RNA from any sample. They offer ... family comprises three systems- KingFisher, KingFisher mL ... 20 - 1000 l. Each system consists ...
... DNA120OP is specifically engineered for efficient drying ... incorporates a glass cover and a post-trap ... unattended, odor-free processing of samples in ammonium ... Synthetic Oligos , ...
... SPD101B is a no-frills, basic SpeedVac concentrator ... economically priced, this unit still features a ... digitial display of time and heat. It ... and accepts a wide variety of different ...
... have active, real-time sample temperature monitoring. , ... worlds first, fully modular SpeedVac System. The ... to form an integrated unit or separated ... the first SpeedVac to have sample temperature ...
Biology Products:
(Date:3/24/2017)... , March 24, 2017 The Controller General of ... Mr. Abdulla Algeen have received the prestigious international IAIR Award ... Continue Reading ... ... and Deputy Controller Abdulla Algeen (small picture on the right) have received ...
(Date:3/22/2017)... 2017   Neurotechnology , a provider of ... announced the release of the SentiVeillance 6.0 ... facial recognition using up to 10 surveillance, security ... The new version uses deep neural-network-based facial detection ... utilizes a Graphing Processing Unit (GPU) for enhanced ...
(Date:3/20/2017)... -- PMD Healthcare announces the release of its new ... (WMS), a remote, real-time lung health monitoring and management ... a Medical Device, Digital Health, and Chronic Care Management ... solutions that empower people to improve their healthcare and ... the first ever personal spirometer, Spiro PD, which was ...
Breaking Biology News(10 mins):
(Date:5/24/2017)... Austin, TX May 24, 2017 (PRWEB) , ... ... ... Require Constant Connectivity , Medical systems are increasingly being developed with Wi-Fi connectivity ... to be easily moved from room to room. In addition, compact mobile devices ...
(Date:5/23/2017)... ... May 23, 2017 , ... Firmex today announced ... it easy for organizations to send and gather large files and confidential documents ... email file size limitations. , Using the same market-tested infrastructure as Firmex’s ...
(Date:5/23/2017)... Linda, Ca (PRWEB) , ... ... ... cells (PSCs) offer an unlimited source of human cardiovascular cells for research ... cardiac-directed differentiation methods makes it possible to generate large numbers of cardiomyocytes ...
(Date:5/23/2017)... , ... May 22, 2017 , ... ... in a row in the Aragon Research Globe™ for Corporate Learning, 2017. , ... industry direction and market demand, and effectively perform against those strategies. NetDimensions’ ranking ...
Breaking Biology Technology: