Navigation Links
Mouse Anti-NFKBIB Monoclonal Antibody, Unconjugated, Clone 2B11 from Abnova Corporation

ProductsMouse Anti-NFKBIB Monoclonal Antibody, Unconjugated, Clone 2B11 from Abnova Corporation
Company Abnova Corporation
Item Mouse Anti-NFKBIB Monoclonal Antibody, Unconjugated, Clone 2B11
Price 
Description Mouse monoclonal antibody raised against a partial recombinant NFKBIB.
Immunogen: NFKBIB (AAH15528, 56 a.a. ~ 145 a.a) partial recombinant protein with GST tag.
Protein Sequence: EDGDTALHLAVIHQHEPFLDFLLGFSAGTEYMDLQNDLGQTALHLAAILGETSTVEKLYAAGAGLCVAERRGHTALHLACRVGAHACARA
Accession: BC015528
Protein Accession Number: AAH15528
OMIM: 604495,
GeneID: 4793
Lot Number: MM951100683
MA Code: ABVAP92OG
Operation Date: 2006/12/22
Info Abnova CorporationAbnova Corporation
Abnova Corporation (HQ)
9th Fl., No. 108, Jhouzih St.
Neihu District, Taipei
114 Taiwan R.O.C.
Tel: +886-2-8751-1888
Fax: +886-2-8751-1166

Abnova GmbH
Boxbergring 107
69126 Heidelberg
Germany
Tel: +49 6221 3632226
Fax: +49 6221 825878

Customer Service: +886-2-8751-1888
Fax Number: +886-2-8751-1166
Web Site: http://www.abnova.com.tw
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Mouse Anti-Amodiaquine Monoclonal Antibody, Unconjugated, Clone 6D10 from AntibodyShop A/S
2. Mouse Anti-Protein S Monoclonal Antibody, Unconjugated, Clone HYB 232-02 from Abcam
3. Mouse Anti-Mouse Glutathione S-transferase M1 (GSTM1) Monoclonal Antibody, Unconjugated from Lifespan Biosciences
4. Mouse Anti-Human S-100 alpha/beta chain Monoclonal Antibody, Unconjugated, Clone 8B10 from Santa Cruz Biotechnology, Inc.
5. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Testis from OriGene Technologies
6. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Brain (adult) from OriGene Technologies
7. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (12.5 - day) from OriGene Technologies
8. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (19 - day) from OriGene Technologies
9. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Thymus from OriGene Technologies
10. Mouse Anti-Human Complement factor B Monoclonal Antibody, Unconjugated, Clone 9B6 from AntibodyShop A/S
11. Mouse Anti-Human Choriongonadotropin (hCG) Monoclonal Antibody, Unconjugated, Clone 5F10 from AntibodyShop A/S
This antibody detects ubiquitinated proteins on SDS-PAGE immunoblots. It does not detect free ubiquitin....
Lysozyme C (W-20)...
Request Info...
Abgene's ALTO-8 is the first automated decapper/capper for Abgene Twist-Lock tubes....
Biology Products:
(Date:1/25/2017)... 2017 The Elements of Enterprise Information Security ... comprised of a comprehensive set of business processes ... digital identities and providing a secured and documented ... significant number of programs opted by enterprises to ... optimizing processes and changing policies. However, there are ...
(Date:1/23/2017)... , Jan. 23, 2017  The latest mobile ... smartphone prices have dropped dramatically. The quarterly average price ... 2013 to $276 in Q4 2016.  There are now ... price of $116, up from just 28 a year ... According to Maxine Most , Acuity Market ...
(Date:1/19/2017)... Calif. , Jan. 19, 2017 ... enhancing user experience and security for consumer electronics, ... next-generation payment processing systems and cybersecurity solutions, today ... banks, enterprises and financial institutions worldwide to bolster ... of the end-to-end secure user authentication platforms they ...
Breaking Biology News(10 mins):
(Date:2/24/2017)... 24, 2017 Provectus Biopharmaceuticals, Inc. (OTCQB: ... a clinical-stage oncology and dermatology biopharmaceutical company, today ... participate in its previously announced rights offering of ... of common stock and Series C Convertible Preferred ... warrants. As previously announced, the ...
(Date:2/24/2017)...  Driven by consumers, preference towards more natural ... growing categories, finds the recently published U.S. volume ... Multi-regional Market Analysis and Opportunities study by ... "Biotechnology actives are derived from natural ... for skin and hair care applications," explains ...
(Date:2/24/2017)... Inc. (NASDAQ: CBPO) ("China Biologic" or the "Company"), a leading ... financial results for the fourth quarter and fiscal year of ... Total sales in the fourth quarter of ... 13.6% in USD terms to $77.6 million from $68.3 million ... profit increased by 13.3% to $46.8 million from $41.3 million ...
(Date:2/23/2017)... NEW YORK , Feb. 23, 2017 ... a leading digital health company, and Digital ... telemedicine and remote patient monitoring, announce they are ... DN Telehealth maximizes collaboration compatibility ... extending consultations beyond a physical clinical setting to ...
Breaking Biology Technology: