Navigation Links
Mouse Anti-NFKBIB Monoclonal Antibody, Unconjugated, Clone 2B11 from Abnova Corporation

ProductsMouse Anti-NFKBIB Monoclonal Antibody, Unconjugated, Clone 2B11 from Abnova Corporation
Company Abnova Corporation
Item Mouse Anti-NFKBIB Monoclonal Antibody, Unconjugated, Clone 2B11
Price 
Description Mouse monoclonal antibody raised against a partial recombinant NFKBIB.
Immunogen: NFKBIB (AAH15528, 56 a.a. ~ 145 a.a) partial recombinant protein with GST tag.
Protein Sequence: EDGDTALHLAVIHQHEPFLDFLLGFSAGTEYMDLQNDLGQTALHLAAILGETSTVEKLYAAGAGLCVAERRGHTALHLACRVGAHACARA
Accession: BC015528
Protein Accession Number: AAH15528
OMIM: 604495,
GeneID: 4793
Lot Number: MM951100683
MA Code: ABVAP92OG
Operation Date: 2006/12/22
Info Abnova CorporationAbnova Corporation
Abnova Corporation (HQ)
9th Fl., No. 108, Jhouzih St.
Neihu District, Taipei
114 Taiwan R.O.C.
Tel: +886-2-8751-1888
Fax: +886-2-8751-1166

Abnova GmbH
Boxbergring 107
69126 Heidelberg
Germany
Tel: +49 6221 3632226
Fax: +49 6221 825878

Customer Service: +886-2-8751-1888
Fax Number: +886-2-8751-1166
Web Site: http://www.abnova.com.tw
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Mouse Anti-Amodiaquine Monoclonal Antibody, Unconjugated, Clone 6D10 from AntibodyShop A/S
2. Mouse Anti-Protein S Monoclonal Antibody, Unconjugated, Clone HYB 232-02 from Abcam
3. Mouse Anti-Mouse Glutathione S-transferase M1 (GSTM1) Monoclonal Antibody, Unconjugated from Lifespan Biosciences
4. Mouse Anti-Human S-100 alpha/beta chain Monoclonal Antibody, Unconjugated, Clone 8B10 from Santa Cruz Biotechnology, Inc.
5. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Testis from OriGene Technologies
6. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Brain (adult) from OriGene Technologies
7. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (12.5 - day) from OriGene Technologies
8. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (19 - day) from OriGene Technologies
9. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Thymus from OriGene Technologies
10. Mouse Anti-Human Complement factor B Monoclonal Antibody, Unconjugated, Clone 9B6 from AntibodyShop A/S
11. Mouse Anti-Human Choriongonadotropin (hCG) Monoclonal Antibody, Unconjugated, Clone 5F10 from AntibodyShop A/S
(Date:5/18/2015)... , May 18, 2015 Fingerprint Cards ... FPC1020, FPC1025, FPC1145, FPC1155 and FPC1035 from one if its ... until and including Q3 2015 and the sensors will be ... Communicated order values for 2015 hereby amount to 740 MSEK ... 2015 of 140 MSEK and a number of smaller orders ...
(Date:5/14/2015)... , May 14, 2015  Verificient Technologies, ... verification and online remote proctoring, announced a ... (SaaS) company and creator of the Canvas ... the two companies will benefit from the ... As a fully integrated multifactor ...
(Date:5/11/2015)... , May 11, 2015  Through a well-rounded UAS delegation ... had a strong showing at AUVSI,s Unmanned 2015 conference ... of Ohio,s UAS industry met with ... from all points along the UAS ecosystem. ... (DDC) Vice President for Aerospace Rich Knoll . "If ...
Breaking Biology News(10 mins):Fingerprint Cards Receives Touch Fingerprint Sensor Order of SEK 230 Million and Raises Revenue Guidance for 2015 2Verificient and Instructure Announce Alliance Partnership to Provide Online Proctoring for K-12 and Higher Education Institutions 2Ohio Flies High at Unmanned '15, Sets Stage for Ohio UAS Conference 2
... free. But we'd all agree it's not worthless. So, ... , In 1997, the University of Vermont's Robert Costanza ... per year in a now-famous paper in the journal ... services" has bloomed. This young discipline studies how nature--through ...
... developed the first-ever genomic test to predict which patients ... and which patients can avoid the toxic regimen of ... save thousands of lives each year by recommending chemotherapy ... the test's developers at Duke's Institute for Genome Sciences ...
... therapy extends average life expectancy and decreases recurrences of ... lung cancer, according to researchers at Rhode Island Hospital. ... seven years, the median survival rate at three years ... months when thermal ablation was followed by radiation for ...
Cached Biology News:What's nature worth? New computer models tell all 2First-ever genomic test predicts which lung cancer patients need chemotherapy to live 2First-ever genomic test predicts which lung cancer patients need chemotherapy to live 3First-ever genomic test predicts which lung cancer patients need chemotherapy to live 4Combined treatment extends life expectancy for lung cancer patients 2Combined treatment extends life expectancy for lung cancer patients 3
(Date:6/1/2015)... -- Research and Markets ( http://www.researchandmarkets.com/research/tdw3ss/2015_strategies ) has ... in the UK Flow Cytometry Market" report ... a comprehensive analysis of the UK flow cytometry ... the French flow cytometry practice, as well as ... with significant market impact during the next five ...
(Date:6/1/2015)... -- Hutchison China MediTech Limited ("Chi-Med") ... ("AstraZeneca"), Hutchison MediPharma Limited,s ("HMP") collaboration partner, presented ... trial of HMP,s c-Met inhibitor savolitinib (AZD6094) combined ... lung cancer ("NSCLC"). AZD9291 is AstraZeneca,s ... (EGFR). Preliminary data on the activity of AZD9291 ...
(Date:5/31/2015)... The most heavily attended and popular session at ... Meeting – “The Plenary Session Including the Science of ... immunotherapy experts and members of the Society for Immunotherapy ... of the Department of Immunology at the University of ... received the Science of Oncology Award. The Science of ...
(Date:5/30/2015)... 2015 The Cholangiocarcinoma Foundation (CCF), ... bile duct cancer, announced today the first grant ... , The Foundation has awarded 5 ... country to raise awareness about cholangiocarcinoma and inspire ... that opens new pathways for diagnosis and drug ...
Breaking Biology Technology:Strategies in the UK Flow Cytometry Market 2015 2Savolitinib (AZD6094) Preliminary Phase Ib Clinical Data in Lung Cancer Presented at the 2015 ASCO Annual Meeting 2Savolitinib (AZD6094) Preliminary Phase Ib Clinical Data in Lung Cancer Presented at the 2015 ASCO Annual Meeting 3SITC Reports on Immunotherapy Insights and Data Featured at ASCO Plenary Session 2The Cholangiocarcinoma Foundation Awards $260,000 in Research Grants 2The Cholangiocarcinoma Foundation Awards $260,000 in Research Grants 3