Navigation Links
Mouse Anti-NFKBIB Monoclonal Antibody, Unconjugated, Clone 2B11 from Abnova Corporation

ProductsMouse Anti-NFKBIB Monoclonal Antibody, Unconjugated, Clone 2B11 from Abnova Corporation
Company Abnova Corporation
Item Mouse Anti-NFKBIB Monoclonal Antibody, Unconjugated, Clone 2B11
Price 
Description Mouse monoclonal antibody raised against a partial recombinant NFKBIB.
Immunogen: NFKBIB (AAH15528, 56 a.a. ~ 145 a.a) partial recombinant protein with GST tag.
Protein Sequence: EDGDTALHLAVIHQHEPFLDFLLGFSAGTEYMDLQNDLGQTALHLAAILGETSTVEKLYAAGAGLCVAERRGHTALHLACRVGAHACARA
Accession: BC015528
Protein Accession Number: AAH15528
OMIM: 604495,
GeneID: 4793
Lot Number: MM951100683
MA Code: ABVAP92OG
Operation Date: 2006/12/22
Info Abnova CorporationAbnova Corporation
Abnova Corporation (HQ)
9th Fl., No. 108, Jhouzih St.
Neihu District, Taipei
114 Taiwan R.O.C.
Tel: +886-2-8751-1888
Fax: +886-2-8751-1166

Abnova GmbH
Boxbergring 107
69126 Heidelberg
Germany
Tel: +49 6221 3632226
Fax: +49 6221 825878

Customer Service: +886-2-8751-1888
Fax Number: +886-2-8751-1166
Web Site: http://www.abnova.com.tw
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Mouse Anti-Amodiaquine Monoclonal Antibody, Unconjugated, Clone 6D10 from AntibodyShop A/S
2. Mouse Anti-Protein S Monoclonal Antibody, Unconjugated, Clone HYB 232-02 from Abcam
3. Mouse Anti-Mouse Glutathione S-transferase M1 (GSTM1) Monoclonal Antibody, Unconjugated from Lifespan Biosciences
4. Mouse Anti-Human S-100 alpha/beta chain Monoclonal Antibody, Unconjugated, Clone 8B10 from Santa Cruz Biotechnology, Inc.
5. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Testis from OriGene Technologies
6. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Brain (adult) from OriGene Technologies
7. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (12.5 - day) from OriGene Technologies
8. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (19 - day) from OriGene Technologies
9. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Thymus from OriGene Technologies
10. Mouse Anti-Human Complement factor B Monoclonal Antibody, Unconjugated, Clone 9B6 from AntibodyShop A/S
11. Mouse Anti-Human Choriongonadotropin (hCG) Monoclonal Antibody, Unconjugated, Clone 5F10 from AntibodyShop A/S
...
Mouse monoclonal antibody to UGT2B10 - UDP glucuronosyltransferase 2 family, polypeptide B10...
Mouse polyclonal antibody raised against a partial recombinant LASS3. NCBI Entrez Gene ID = 204219...
... SM-2 adsorbents are macroporous polystyrene beads for ... surface area for adsorbing organics of molecular ... The beads are useful for the adsorption ... for example, the removal of detergents such ...
Biology Products:
(Date:11/16/2016)... Calif. , Nov. 16, 2016 ... user experience and security for consumer electronics, and ... the financial and retail industry, today announced a ... and convenient way to authenticate users of mobile ... Sensory,s TrulySecure™ software which requires no ...
(Date:11/14/2016)... Fla., Nov. 14, 2016  xG Technology, Inc. ("xG" ... providing critical wireless communications for use in challenging operating ... September 30, 2016. Management will hold a conference call ... 5:00 p.m. Eastern Time (details below). Key ... a $16 million binding agreement to acquire Vislink Communication ...
(Date:6/22/2016)... 2016  The American College of Medical Genetics and Genomics ... as one of the fastest-growing trade shows during the ... Bellagio in Las Vegas . ... growth in each of the following categories: net square feet ... of attendees. The 2015 ACMG Annual Meeting was ranked 23 ...
Breaking Biology News(10 mins):
(Date:12/5/2016)... , Dec 5, 2016 Research ... report "DNA Sequencing - Technologies, Markets and Companies" ... ... report briefly reviews basics of human genome variations, development of ... are described as well as companies developing them. Various applications ...
(Date:12/4/2016)... , Dec. 3, 2016  In five studies ... Hematology (ASH) Annual Meeting and Exposition in ... engineering methods to improve the delivery of life-saving treatments ... new methods are designed to carry therapies directly to ... most, which could provide a substantial advantage over traditional, ...
(Date:12/2/2016)... 2016  The Multiple Myeloma Research Foundation (MMRF) today ... Study SM —the largest and most comprehensive study driving ... myeloma—will be presented at the 58 th American ... San Diego from December 3-6. ... as well as identify pathways and targets for new ...
(Date:12/2/2016)... ... ... ACEA Biosciences, Inc. announced today that it will be presenting updated efficacy ... Conference on Lung Cancer 2016, taking place in Vienna, Austria December 3rd-8th. , ... AC0010 in patients with advanced non-small cell lung cancer harboring the EGFR T790M resistance ...
Breaking Biology Technology: