Navigation Links
Mouse Anti-NFKBIB Monoclonal Antibody, Unconjugated, Clone 2B11 from Abnova Corporation

ProductsMouse Anti-NFKBIB Monoclonal Antibody, Unconjugated, Clone 2B11 from Abnova Corporation
Company Abnova Corporation
Item Mouse Anti-NFKBIB Monoclonal Antibody, Unconjugated, Clone 2B11
Price 
Description Mouse monoclonal antibody raised against a partial recombinant NFKBIB.
Immunogen: NFKBIB (AAH15528, 56 a.a. ~ 145 a.a) partial recombinant protein with GST tag.
Protein Sequence: EDGDTALHLAVIHQHEPFLDFLLGFSAGTEYMDLQNDLGQTALHLAAILGETSTVEKLYAAGAGLCVAERRGHTALHLACRVGAHACARA
Accession: BC015528
Protein Accession Number: AAH15528
OMIM: 604495,
GeneID: 4793
Lot Number: MM951100683
MA Code: ABVAP92OG
Operation Date: 2006/12/22
Info Abnova CorporationAbnova Corporation
Abnova Corporation (HQ)
9th Fl., No. 108, Jhouzih St.
Neihu District, Taipei
114 Taiwan R.O.C.
Tel: +886-2-8751-1888
Fax: +886-2-8751-1166

Abnova GmbH
Boxbergring 107
69126 Heidelberg
Germany
Tel: +49 6221 3632226
Fax: +49 6221 825878

Customer Service: +886-2-8751-1888
Fax Number: +886-2-8751-1166
Web Site: http://www.abnova.com.tw
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Mouse Anti-Amodiaquine Monoclonal Antibody, Unconjugated, Clone 6D10 from AntibodyShop A/S
2. Mouse Anti-Protein S Monoclonal Antibody, Unconjugated, Clone HYB 232-02 from Abcam
3. Mouse Anti-Mouse Glutathione S-transferase M1 (GSTM1) Monoclonal Antibody, Unconjugated from Lifespan Biosciences
4. Mouse Anti-Human S-100 alpha/beta chain Monoclonal Antibody, Unconjugated, Clone 8B10 from Santa Cruz Biotechnology, Inc.
5. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Testis from OriGene Technologies
6. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Brain (adult) from OriGene Technologies
7. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (12.5 - day) from OriGene Technologies
8. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (19 - day) from OriGene Technologies
9. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Thymus from OriGene Technologies
10. Mouse Anti-Human Complement factor B Monoclonal Antibody, Unconjugated, Clone 9B6 from AntibodyShop A/S
11. Mouse Anti-Human Choriongonadotropin (hCG) Monoclonal Antibody, Unconjugated, Clone 5F10 from AntibodyShop A/S
The Discovery Series PDQuest 2-D analysis software is used for imaging, analyzing, and databasing two-dimensional electrophoretic gels. The 10-user network license entitles ten users to access data f...
Mouse monoclonal antibody raised against a partial recombinant NR4A2. NCBI Entrez Gene ID = NR4A2...
... Polymorphic DNA Technologies also offers a DNA ... of templates including plasmids, PCR products, BACs, ... customer-provided templates such as purified plasmids or ... liquid handling robotics optimized for automated reaction ...
... NightOWL is a dedicated imaging system ... size. Equipped with a very sensitive camera ... or plants in tumor research, infectious disease ... Western blots. NightOWL is the only imager ...
Biology Products:
(Date:8/20/2014)... When a colony of honeybees grows to about 4,000 ... reproductive cycle: the building of a special type of ... team of experts from the Department of Neurobiology and ... what starts the reproductive cycle of honeybee colonies. The ... The Science of Nature . , Reproduction isn,t ...
(Date:8/19/2014)... be made to decrease China,s increasing caesarean section rate, ... BJOG: An International Journal of Obstetrics and Gynaecology ... caesarean delivery rates in the world. Of 16 million ... Although the exact rate is not known, the current ... total caesarean rates ranging from 36% to 58%. However, ...
(Date:8/19/2014)... lemur. It,s not an African Bush Baby or even a ... downright "cool" primate from Southeast Asia. , "It,s really not ... Brown, curator-in-charge at the University of Kansas, Biodiversity Institute. "A ... body; a long tail with a furry tuft at the ... a bit like the disks on the digits of tree ...
Breaking Biology News(10 mins):Worker bees 'know' when to invest in their reproductive future 2Is China's 50 percent cesarean section delivery rate too high? 2Is China's 50 percent cesarean section delivery rate too high? 3Philippine tarsier gets boost from Kansas research, and genetic proof of a new variety 2Philippine tarsier gets boost from Kansas research, and genetic proof of a new variety 3
... DENVER Researchers have linked a variant in the ... chronic obstructive pulmonary disease (COPD) in Caucasian men. The ... Normative Aging Study, a multidisciplinary study of aging that ... presented at the ATS 2011 International Conference. "Our ...
... the process of converting the genetic information encoded in ... protein or any of several types of RNA. Scientists ... different physiological processes throughout the body are robustly pre-determined ... new study by researchers from the University of California, ...
... Most people who have had the experience of having ... the animals can "recognize" us. They seem to recognize our ... they respond to us differently from other people. , Actually, ... shown that domesticated animals, such as honey bees, chickens, pigeons, ...
Cached Biology News:Gene variant linked with development of COPD in men 2Plasticity of hormonal response permits rapid gene expression reprogramming 2I know you, bad guy! 2I know you, bad guy! 3
(Date:8/20/2014)... your ear could improve the health of your heart, ... of Leeds used a standard TENS machine like those ... to the tragus, the small raised flap at the ... ear canal. , The stimulation changed the influence of ... nervous signals that can drive failing hearts too hard. ...
(Date:8/19/2014)... One of the major limitations ... inadequate vascular supply. Nutrient and gas transport throughout ... critical for successful regeneration and integration into the ... in vascularization and promote angiogenesis in a variety ... design and architecture, and enhancing scaffolds with stem ...
(Date:8/19/2014)... A Geisinger researcher on a personal crusade ... for Disease Control and Prevention (CDC) award recognizing his ... Joseph Boscarino , Ph.D. MPH, senior ... of researchers nominated for the Centers for Disease Control ... Data Methods and Study Design. "Hepatitis C ...
(Date:8/19/2014)... 19, 2014 Robin Williams’ passing is ... take on an individual. Symptoms range from slowness ... problems swallowing and severe depression. Parkinson’s disease progressively ... of dopamine producing neurons of the brain. As ... that slowly and progressively gets worse, they look for ...
Breaking Biology Technology:'Tickling' your ear could be good for your heart 2Vascularization in Tissue Engineering Highlighted at 12th New Jersey Symposium on Biomaterials Science 2Geisinger investigator nominated for federal award 2Geisinger investigator nominated for federal award 3As We Mourn Robin Williams’ Passing, His Death Sheds Light on Patients Struggling with Parkinson’s Disease 2As We Mourn Robin Williams’ Passing, His Death Sheds Light on Patients Struggling with Parkinson’s Disease 3