Navigation Links
Mouse Anti-NFKBIB Monoclonal Antibody, Unconjugated, Clone 2B11 from Abnova Corporation

ProductsMouse Anti-NFKBIB Monoclonal Antibody, Unconjugated, Clone 2B11 from Abnova Corporation
Company Abnova Corporation
Item Mouse Anti-NFKBIB Monoclonal Antibody, Unconjugated, Clone 2B11
Price 
Description Mouse monoclonal antibody raised against a partial recombinant NFKBIB.
Immunogen: NFKBIB (AAH15528, 56 a.a. ~ 145 a.a) partial recombinant protein with GST tag.
Protein Sequence: EDGDTALHLAVIHQHEPFLDFLLGFSAGTEYMDLQNDLGQTALHLAAILGETSTVEKLYAAGAGLCVAERRGHTALHLACRVGAHACARA
Accession: BC015528
Protein Accession Number: AAH15528
OMIM: 604495,
GeneID: 4793
Lot Number: MM951100683
MA Code: ABVAP92OG
Operation Date: 2006/12/22
Info Abnova CorporationAbnova Corporation
Abnova Corporation (HQ)
9th Fl., No. 108, Jhouzih St.
Neihu District, Taipei
114 Taiwan R.O.C.
Tel: +886-2-8751-1888
Fax: +886-2-8751-1166

Abnova GmbH
Boxbergring 107
69126 Heidelberg
Germany
Tel: +49 6221 3632226
Fax: +49 6221 825878

Customer Service: +886-2-8751-1888
Fax Number: +886-2-8751-1166
Web Site: http://www.abnova.com.tw
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Mouse Anti-Amodiaquine Monoclonal Antibody, Unconjugated, Clone 6D10 from AntibodyShop A/S
2. Mouse Anti-Protein S Monoclonal Antibody, Unconjugated, Clone HYB 232-02 from Abcam
3. Mouse Anti-Mouse Glutathione S-transferase M1 (GSTM1) Monoclonal Antibody, Unconjugated from Lifespan Biosciences
4. Mouse Anti-Human S-100 alpha/beta chain Monoclonal Antibody, Unconjugated, Clone 8B10 from Santa Cruz Biotechnology, Inc.
5. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Testis from OriGene Technologies
6. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Brain (adult) from OriGene Technologies
7. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (12.5 - day) from OriGene Technologies
8. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (19 - day) from OriGene Technologies
9. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Thymus from OriGene Technologies
10. Mouse Anti-Human Complement factor B Monoclonal Antibody, Unconjugated, Clone 9B6 from AntibodyShop A/S
11. Mouse Anti-Human Choriongonadotropin (hCG) Monoclonal Antibody, Unconjugated, Clone 5F10 from AntibodyShop A/S
...
ras-related C3 botulinum toxin substrate 2 (rho family, small GTP binding protein Rac2)...
RayBio L Series 507: RayBio Label-based Antibody Array I (2 membranes) Class: Antibody Array Products Product Group: Antibody Array...
... Removal of excess dye terminators, template ... from the true sequencing products have proved ... This product is designed to work with ... BigDyeTM and DYEnamicTM ET. The unique uniformity ...
Biology Products:
(Date:10/3/2018)... ... October 03, 2018 , ... ... development and commercialization of first-in-class stromal cell immunotherapies, announced that ORBCEL-M™, a ... type 2 diabetes and progressive diabetic kidney disease in a four-site, pan-European ...
(Date:10/2/2018)... ... October 02, 2018 , ... Stuart is a fun-loving eight-year-old Labrador retriever. Like many ... owner, Cynthia, “He loves playing ball so much that whenever anyone comes to our door, ... a game of fetch.” In early 2017, Stuart began limping and eventually could no ...
(Date:10/2/2018)... (PRWEB) , ... October 02, 2018 , ... ... during September 25th to 27th, 2018 at Tampa Convention Center. The Palo Alto-based ... Enforcement & Biometrics session on September 27th. Other speakers included U.S. Federal executives ...
Breaking Biology News(10 mins):
(Date:9/24/2018)... ... September 24, 2018 , ... ReGrow Helmet , the most advanced laser ... affordable option for hair regrowth in the comfort of one’s home. Early campaign backers ... , The sophisticated design and advanced technology of the ReGrow Helmet will lead ...
(Date:9/22/2018)... ... September 21, 2018 , ... ... tissue function, development, and pathogenesis requires tools that can rapidly and consistently ... Multiplexed Ion Beam Imaging by Time-Of-Flight (MIBI-TOF) detects elements from hydrogen to ...
(Date:9/13/2018)... ... ... Asymmetrex’s director, James L. Sherley, M.D., Ph.D., asks audiences questions like, “How ... the means to measure the number of drug molecules in drug development research or ... holding up progress in stem cell medicine.” , “Can you imagine taking an approved ...
(Date:9/12/2018)... ... September 11, 2018 , ... Sterlitech Corporation, a ... Osmosis (FO) membranes from Fluid Technology Solutions (FTS H2O) to their offering of ... constructed from cellulose triacetate (CTA) material. The highly hydrophilic nature of the CTA ...
Breaking Biology Technology: