Navigation Links
Mouse Anti-NFKBIB Monoclonal Antibody, Unconjugated, Clone 2B11 from Abnova Corporation

ProductsMouse Anti-NFKBIB Monoclonal Antibody, Unconjugated, Clone 2B11 from Abnova Corporation
Company Abnova Corporation
Item Mouse Anti-NFKBIB Monoclonal Antibody, Unconjugated, Clone 2B11
Price 
Description Mouse monoclonal antibody raised against a partial recombinant NFKBIB.
Immunogen: NFKBIB (AAH15528, 56 a.a. ~ 145 a.a) partial recombinant protein with GST tag.
Protein Sequence: EDGDTALHLAVIHQHEPFLDFLLGFSAGTEYMDLQNDLGQTALHLAAILGETSTVEKLYAAGAGLCVAERRGHTALHLACRVGAHACARA
Accession: BC015528
Protein Accession Number: AAH15528
OMIM: 604495,
GeneID: 4793
Lot Number: MM951100683
MA Code: ABVAP92OG
Operation Date: 2006/12/22
Info Abnova CorporationAbnova Corporation
Abnova Corporation (HQ)
9th Fl., No. 108, Jhouzih St.
Neihu District, Taipei
114 Taiwan R.O.C.
Tel: +886-2-8751-1888
Fax: +886-2-8751-1166

Abnova GmbH
Boxbergring 107
69126 Heidelberg
Germany
Tel: +49 6221 3632226
Fax: +49 6221 825878

Customer Service: +886-2-8751-1888
Fax Number: +886-2-8751-1166
Web Site: http://www.abnova.com.tw
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Mouse Anti-Amodiaquine Monoclonal Antibody, Unconjugated, Clone 6D10 from AntibodyShop A/S
2. Mouse Anti-Protein S Monoclonal Antibody, Unconjugated, Clone HYB 232-02 from Abcam
3. Mouse Anti-Mouse Glutathione S-transferase M1 (GSTM1) Monoclonal Antibody, Unconjugated from Lifespan Biosciences
4. Mouse Anti-Human S-100 alpha/beta chain Monoclonal Antibody, Unconjugated, Clone 8B10 from Santa Cruz Biotechnology, Inc.
5. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Testis from OriGene Technologies
6. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Brain (adult) from OriGene Technologies
7. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (12.5 - day) from OriGene Technologies
8. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (19 - day) from OriGene Technologies
9. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Thymus from OriGene Technologies
10. Mouse Anti-Human Complement factor B Monoclonal Antibody, Unconjugated, Clone 9B6 from AntibodyShop A/S
11. Mouse Anti-Human Choriongonadotropin (hCG) Monoclonal Antibody, Unconjugated, Clone 5F10 from AntibodyShop A/S
Mouse monoclonal antibody to ST8SIA2 - ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 2...
... NightOWL is a dedicated imaging system for ... Equipped with a very sensitive camera to ... plants in tumor research, infectious disease research, ... blots. NightOWL is the only imager with ...
... and Sorter) large particle flow cytometers from ... cytometry to applications that were not previously ... sorting. Our instruments are based on ... but are designed to accommodate much larger ...
Mouse polyclonal antibody raised against a partial recombinant TSEN2. NCBI Entrez Gene ID = 80746...
Biology Products:
(Date:7/20/2017)... Delta (NYSE: DAL ) customers now can use fingerprints instead ... National Airport (DCA). ... Delta launches biometrics to board aircraft at Reagan Washington National Airport ... Delta,s biometric boarding pass experience that launched in ... the boarding process to allow eligible Delta SkyMiles Members who are enrolled ...
(Date:5/16/2017)... , May 16, 2017  Veratad Technologies, LLC ( ... online age and identity verification solutions, announced today they ... Conference 2017, May 15 thru May 17, 2017, in ... and International Trade Center. Identity impacts ... and in today,s quickly evolving digital world, defining identity ...
(Date:4/18/2017)... , April 18, 2017  Socionext Inc., a global expert ... a media edge server, the M820, which features the company,s hybrid ... software provided by Tera Probe, Inc., will be showcased during the ... the NAB show at the Las Vegas ... ...
Breaking Biology News(10 mins):
(Date:8/15/2017)... ... August 15, 2017 , ... ... that accelerate pharmaceutical and biotherapeutics development, announces the launch of the new ... needed to gain kinetic binding data for a wide range of molecules, including ...
(Date:8/15/2017)... ... August 15, 2017 , ... ... threatened by various biotic and abiotic factors. During this educational webinar, participants will ... coffee, as well as gain a better understanding of how genomics is important ...
(Date:8/11/2017)... , Aug. 11, 2017  Market researcher ... York Times article regarding the telemedicine market.  ... to Kalorama Information.  The article, "Heart ... That"  used information from Kalorama Information,s ... & Telemedicine Market  (Sleep, Diabetes, Vital ...
(Date:8/10/2017)... ... August 09, 2017 , ... Teachers ... as students. From August 14th through the 16th, the University City Science Center ... the summer of 2016, provides Philadelphia-based middle school educators an opportunity for professional ...
Breaking Biology Technology: