Navigation Links
Mouse Anti-NFKBIB Monoclonal Antibody, Unconjugated, Clone 2B11 from Abnova Corporation

ProductsMouse Anti-NFKBIB Monoclonal Antibody, Unconjugated, Clone 2B11 from Abnova Corporation
Company Abnova Corporation
Item Mouse Anti-NFKBIB Monoclonal Antibody, Unconjugated, Clone 2B11
Price 
Description Mouse monoclonal antibody raised against a partial recombinant NFKBIB.
Immunogen: NFKBIB (AAH15528, 56 a.a. ~ 145 a.a) partial recombinant protein with GST tag.
Protein Sequence: EDGDTALHLAVIHQHEPFLDFLLGFSAGTEYMDLQNDLGQTALHLAAILGETSTVEKLYAAGAGLCVAERRGHTALHLACRVGAHACARA
Accession: BC015528
Protein Accession Number: AAH15528
OMIM: 604495,
GeneID: 4793
Lot Number: MM951100683
MA Code: ABVAP92OG
Operation Date: 2006/12/22
Info Abnova CorporationAbnova Corporation
Abnova Corporation (HQ)
9th Fl., No. 108, Jhouzih St.
Neihu District, Taipei
114 Taiwan R.O.C.
Tel: +886-2-8751-1888
Fax: +886-2-8751-1166

Abnova GmbH
Boxbergring 107
69126 Heidelberg
Germany
Tel: +49 6221 3632226
Fax: +49 6221 825878

Customer Service: +886-2-8751-1888
Fax Number: +886-2-8751-1166
Web Site: http://www.abnova.com.tw
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Mouse Anti-Amodiaquine Monoclonal Antibody, Unconjugated, Clone 6D10 from AntibodyShop A/S
2. Mouse Anti-Protein S Monoclonal Antibody, Unconjugated, Clone HYB 232-02 from Abcam
3. Mouse Anti-Mouse Glutathione S-transferase M1 (GSTM1) Monoclonal Antibody, Unconjugated from Lifespan Biosciences
4. Mouse Anti-Human S-100 alpha/beta chain Monoclonal Antibody, Unconjugated, Clone 8B10 from Santa Cruz Biotechnology, Inc.
5. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Testis from OriGene Technologies
6. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Brain (adult) from OriGene Technologies
7. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (12.5 - day) from OriGene Technologies
8. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (19 - day) from OriGene Technologies
9. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Thymus from OriGene Technologies
10. Mouse Anti-Human Complement factor B Monoclonal Antibody, Unconjugated, Clone 9B6 from AntibodyShop A/S
11. Mouse Anti-Human Choriongonadotropin (hCG) Monoclonal Antibody, Unconjugated, Clone 5F10 from AntibodyShop A/S
... Mouse L1210 cells were cultured in DMEM and ... In order to keep the antigens in their ... The cells are arrayed on a 12-well (5 ... specifically treated to enhance cellular attachment and to ...
...
Multi-enzyme complex containing a wide range of carbohydrases, including arabanase, cellulase,b-glucanase, hemi-cellulase and xylanase Patent/trademark/license (electronic): A product of Novozyme Cor...
Miscellaneous: Versatile stain for staining RNA (bluish-purple), DNA (blue), proteins (red) and acid polysaccharides Assay: ~ 95 % Suitab tst: differential staining of nucleic acids and prote...
Biology Products:
(Date:6/11/2019)... , ... June 10, 2019 , ... Improved Pharma LLC ... July 2019 issue of AAPS PharmSciTech. The article was published online on April 29th, ... Improved Pharma, along with Xiaoming Sean Chen of Purdue University. , The article is ...
(Date:6/4/2019)... ... June 04, 2019 , ... Molecular Devices, a ... Murphy as the new President of Molecular Devices, replacing Greg Milosevich who has ... Danaher Corporation. , Since joining Molecular Devices in a scientific engineering role, Ms. ...
(Date:6/1/2019)... ... May 31, 2019 , ... The University of Vermont Health ... BioFactura’s $6M Series B Financing Round. , “With the commitment from the ... significant financial and business resources to bear as we advance our biopharmaceutical products ...
Breaking Biology News(10 mins):
(Date:5/31/2019)... , ... May 30, 2019 , ... ... is pleased to announce the strategic acquisition of Metabiologics, Inc., a globally recognized ... provides Object exclusive ownership and commercialization rights to a full spectrum of botulinum ...
(Date:5/15/2019)... ... May 16, 2019 , ... Emulsifiers ... result, food and beverage products rely on these ingredients to create stable quality ... label declarations. This paradigm shift triggers food formulators to seek out alternatives for ...
(Date:5/4/2019)... ... May 03, 2019 , ... More than ... Dakila Pesquisas Association, the scientist and ufologist Urandir Fernandes de Oliveira, last Thursday ... detailed the results of some research carried out by the association, in partnership ...
(Date:5/2/2019)... Calif. (PRWEB) , ... May 02, 2019 , ... ... clinical genetics testing company, will present results documenting discrepancies between U.S. insurer policies ... guidelines for patients at risk for hereditary breast and ovarian cancer (HBOC). ...
Breaking Biology Technology: