Navigation Links
Mouse Anti-NFKBIB Monoclonal Antibody, Unconjugated, Clone 2B11 from Abnova Corporation

ProductsMouse Anti-NFKBIB Monoclonal Antibody, Unconjugated, Clone 2B11 from Abnova Corporation
Company Abnova Corporation
Item Mouse Anti-NFKBIB Monoclonal Antibody, Unconjugated, Clone 2B11
Price 
Description Mouse monoclonal antibody raised against a partial recombinant NFKBIB.
Immunogen: NFKBIB (AAH15528, 56 a.a. ~ 145 a.a) partial recombinant protein with GST tag.
Protein Sequence: EDGDTALHLAVIHQHEPFLDFLLGFSAGTEYMDLQNDLGQTALHLAAILGETSTVEKLYAAGAGLCVAERRGHTALHLACRVGAHACARA
Accession: BC015528
Protein Accession Number: AAH15528
OMIM: 604495,
GeneID: 4793
Lot Number: MM951100683
MA Code: ABVAP92OG
Operation Date: 2006/12/22
Info Abnova CorporationAbnova Corporation
Abnova Corporation (HQ)
9th Fl., No. 108, Jhouzih St.
Neihu District, Taipei
114 Taiwan R.O.C.
Tel: +886-2-8751-1888
Fax: +886-2-8751-1166

Abnova GmbH
Boxbergring 107
69126 Heidelberg
Germany
Tel: +49 6221 3632226
Fax: +49 6221 825878

Customer Service: +886-2-8751-1888
Fax Number: +886-2-8751-1166
Web Site: http://www.abnova.com.tw
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Mouse Anti-Amodiaquine Monoclonal Antibody, Unconjugated, Clone 6D10 from AntibodyShop A/S
2. Mouse Anti-Protein S Monoclonal Antibody, Unconjugated, Clone HYB 232-02 from Abcam
3. Mouse Anti-Mouse Glutathione S-transferase M1 (GSTM1) Monoclonal Antibody, Unconjugated from Lifespan Biosciences
4. Mouse Anti-Human S-100 alpha/beta chain Monoclonal Antibody, Unconjugated, Clone 8B10 from Santa Cruz Biotechnology, Inc.
5. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Testis from OriGene Technologies
6. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Brain (adult) from OriGene Technologies
7. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (12.5 - day) from OriGene Technologies
8. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (19 - day) from OriGene Technologies
9. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Thymus from OriGene Technologies
10. Mouse Anti-Human Complement factor B Monoclonal Antibody, Unconjugated, Clone 9B6 from AntibodyShop A/S
11. Mouse Anti-Human Choriongonadotropin (hCG) Monoclonal Antibody, Unconjugated, Clone 5F10 from AntibodyShop A/S
... the lowest priced, full ring small animal ... Despite the microPET R4 low retail price, ... performance categories; count rate performance, energy resolution, ... a dedicated small animal PET (Positron Emission ...
...
... StatMatic I provides a convenient and affordable ... work. Used with an eight-port disposable manifold, ... possible with multi-channel pipettes. The eight-port manifold, ... volumes of 100, 200, 250, or 300mL ...
384 Well PCR Plate Carrier for Thermo-Sealer...
Biology Products:
(Date:8/18/2015)... Aug. 17, 2015 Research and Markets ... the "Global Biometric Authentication & Identification Market: ... & Forecast, 2015-2020" report to their offering. ... identification systems market is expected to grow at ... 2020 and generate over $25 billion (approximately) by ...
(Date:8/12/2015)...   MedNet Solutions , an innovative SaaS-based eClinical ... research, is proud to announce that iMedNet ... technology platform, has led the way to significant and ... 2015.   Q2 2015 and Q1 2015 were, respectively, ... value sold in the company,s 15 year history.  In ...
(Date:8/12/2015)... YORK , Aug. 12, 2015  New ... hackers can attack Android phones to steal users, ... the increasing availability of fingerprint scanners on mobile ... utmost concern. To secure biometrics on mobile devices, ... to augment these convenient authentication systems with strong ...
Breaking Biology News(10 mins):Global Biometric Authentication & Identification Market 2015: Focus On Modality, Motility & Application - Estimation & Forecasts to 2020 for the $25 Billion Industry 2MedNet Solutions Experiences Explosive Corporate Growth 2HYPR Corp. Addresses Android Vulnerability That Exposes Ecosystem-wide Biometric Security Challenges 2HYPR Corp. Addresses Android Vulnerability That Exposes Ecosystem-wide Biometric Security Challenges 3
... Technological University (NTU) and Rice University (Rice), a ... jointly establish the Institute of Sustainable and Applied ... bi-national institute will create new science and engineer ... other radical new information technologies that are more ...
... the ability of ecosystems to perform vital servicessuch ... the nation,s largest organization of ecological scientists. In ... America (ESA) outlines strategies that focus on restoring ... adapt to climate change. "Decision-makers cannot overlook ...
... new study from plant biologists at UC Davis shows that ... the membranes of chloroplasts, just as they do for other ... January issue of the journal The Plant Cell . ... cell is to move things across membranes, both in and ...
Cached Biology News:NTU, Rice establish infodynamics institute 2NTU, Rice establish infodynamics institute 3Managing ecosystems in a changing climate 2Managing ecosystems in a changing climate 3Green plant transport mystery solved 2
(Date:8/27/2015)... 2015 /PRNewswire/ - Portage Biotech Inc. ("Portage") (OTC ... Pharmaceutical Holding Company Limited (Biohaven), announced today that ... of BHV-0223, a glutamate modulating agent. Biohaven filed ... recently obtained clearance from the U.S. Food and ... Portage holds 54% equity interest in Biohaven, a ...
(Date:8/27/2015)... August 27, 2015 GlassesOff (OTCBB: GLSO), ... functions in the human vision system, announced today a partnership ... guard Chris Paul to develop a new mobile ... to improve their real-life on-court performance. Vision is ... it is shooting a ball or blocking a pass. The ...
(Date:8/26/2015)... , ... August 26, 2015 , ... ... announces today that a second US laboratory is to open in Manhattan, Kansas ... the continued partnership and long-term growth of research and development through collaboration with ...
(Date:8/26/2015)...  Platform therapeutic company Symic Biomedical, Inc. ("Symic") ... Phase II SBIR grant from the National Institutes ... agent to reduce arteriovenous fistula (AVF) failures, a ... disease (ESRD) patients undergoing hemodialysis. The two-year project, ... Digestive and Kidney Diseases (NIDDK), will allow Symic ...
Breaking Biology Technology:Portage's Biohaven doses first human subject in Phase 1 trial with lead drug candidate BHV-0223 2Portage's Biohaven doses first human subject in Phase 1 trial with lead drug candidate BHV-0223 3Portage's Biohaven doses first human subject in Phase 1 trial with lead drug candidate BHV-0223 4Eight-Time All-Star Chris Paul and GlassesOff Partner to Develop Innovative Mobile App Designed to Improve On-Court Performance 2Eight-Time All-Star Chris Paul and GlassesOff Partner to Develop Innovative Mobile App Designed to Improve On-Court Performance 3MediVet Biologics Animal Health Secures Additional Laboratory Facility in Manhattan, Kansas 2MediVet Biologics Animal Health Secures Additional Laboratory Facility in Manhattan, Kansas 3Symic Biomedical Awarded $1.5MM NIH Phase II SBIR Grant to Develop its Proteoglycan Mimetic Therapeutics to Reduce Vascular Access Failures in ESRD 2Symic Biomedical Awarded $1.5MM NIH Phase II SBIR Grant to Develop its Proteoglycan Mimetic Therapeutics to Reduce Vascular Access Failures in ESRD 3