Navigation Links
Mouse Anti-NFKBIB Monoclonal Antibody, Unconjugated, Clone 2B11 from Abnova Corporation

ProductsMouse Anti-NFKBIB Monoclonal Antibody, Unconjugated, Clone 2B11 from Abnova Corporation
Company Abnova Corporation
Item Mouse Anti-NFKBIB Monoclonal Antibody, Unconjugated, Clone 2B11
Price 
Description Mouse monoclonal antibody raised against a partial recombinant NFKBIB.
Immunogen: NFKBIB (AAH15528, 56 a.a. ~ 145 a.a) partial recombinant protein with GST tag.
Protein Sequence: EDGDTALHLAVIHQHEPFLDFLLGFSAGTEYMDLQNDLGQTALHLAAILGETSTVEKLYAAGAGLCVAERRGHTALHLACRVGAHACARA
Accession: BC015528
Protein Accession Number: AAH15528
OMIM: 604495,
GeneID: 4793
Lot Number: MM951100683
MA Code: ABVAP92OG
Operation Date: 2006/12/22
Info Abnova CorporationAbnova Corporation
Abnova Corporation (HQ)
9th Fl., No. 108, Jhouzih St.
Neihu District, Taipei
114 Taiwan R.O.C.
Tel: +886-2-8751-1888
Fax: +886-2-8751-1166

Abnova GmbH
Boxbergring 107
69126 Heidelberg
Germany
Tel: +49 6221 3632226
Fax: +49 6221 825878

Customer Service: +886-2-8751-1888
Fax Number: +886-2-8751-1166
Web Site: http://www.abnova.com.tw
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Mouse Anti-Amodiaquine Monoclonal Antibody, Unconjugated, Clone 6D10 from AntibodyShop A/S
2. Mouse Anti-Protein S Monoclonal Antibody, Unconjugated, Clone HYB 232-02 from Abcam
3. Mouse Anti-Mouse Glutathione S-transferase M1 (GSTM1) Monoclonal Antibody, Unconjugated from Lifespan Biosciences
4. Mouse Anti-Human S-100 alpha/beta chain Monoclonal Antibody, Unconjugated, Clone 8B10 from Santa Cruz Biotechnology, Inc.
5. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Testis from OriGene Technologies
6. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Brain (adult) from OriGene Technologies
7. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (12.5 - day) from OriGene Technologies
8. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (19 - day) from OriGene Technologies
9. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Thymus from OriGene Technologies
10. Mouse Anti-Human Complement factor B Monoclonal Antibody, Unconjugated, Clone 9B6 from AntibodyShop A/S
11. Mouse Anti-Human Choriongonadotropin (hCG) Monoclonal Antibody, Unconjugated, Clone 5F10 from AntibodyShop A/S
anti-Lactate Dehydrogenase...
Mouse monoclonal [6E10] to LAP2 ( Abpromise for all tested applications). entrezGeneID: 7112 SwissProtID: P42166...
Alkali soluble casein is the recommended blot blocking reagent for use with the HisTag Monoclonal Antibody (Novagen) on Western blots....
... reagent has been developed for use ... reduction of nonspecific background staining due ... describe blocking peroxidase with hydrogen peroxide. ... in combination with additional novel components ...
Biology Products:
(Date:3/23/2017)... 2017 The report "Gesture Recognition and Touchless Sensing Market ... - Global Forecast to 2022", published by MarketsandMarkets, the market is expected to ... between 2017 and 2022. Continue Reading ... ... ...
(Date:3/22/2017)... 2017 Vigilant Solutions , a vehicle ... agencies, announced today the appointment of retired FBI special ... safety business development. Mr. Sheridan brings more ... a focus on the aviation transportation sector, to his ... Mr. Sheridan served as the Aviation Liaison Agent Coordinator ...
(Date:3/13/2017)... Germany , March 13, 2017 Future of security: ... ... DERMALOGs Face Matching enables to match face ... forms the basis to identify individuals. (PRNewsFoto/Dermalog Identification Systems) ... DERMALOG,s "Face Matching" is the fastest software for biometric ...
Breaking Biology News(10 mins):
(Date:4/21/2017)... ... April 21, 2017 , ... ... to nourishing a range of emerging technology-based businesses, recently earned a $77,518 grant ... location. , Founded in 2004, FITCI is Frederick’s first incubator. A non-profit ...
(Date:4/20/2017)... BARBARA, CALIFORNIA (PRWEB) , ... April 20, 2017 , ... ... optimization firm for the life sciences and healthcare industries, is pleased to announce ... the new established USDM subsidiary “USDM Europe GmbH” based in Germany. , Braemer ...
(Date:4/20/2017)... ... April 20, 2017 , ... ... technology applications, announced today that Chief Executive Officer (CEO) Debbie Gustafson has been ... is the global industry association connecting the electronics manufacturing supply chain. The mission ...
(Date:4/20/2017)... Israel , April 20, 2017  BrainStorm Cell ... cell technologies for neurodegenerative diseases, announced today that Chaim ... for Regenerative Medicine,s (ARM) 5 th Annual Cell & ... 09:40 EDT in Boston . ... Medical Officer & Chief Operating Officer, will participate in a ...
Breaking Biology Technology: