Navigation Links
Mouse Anti-NFKBIB Monoclonal Antibody, Unconjugated, Clone 2B11 from Abnova Corporation

ProductsMouse Anti-NFKBIB Monoclonal Antibody, Unconjugated, Clone 2B11 from Abnova Corporation
Company Abnova Corporation
Item Mouse Anti-NFKBIB Monoclonal Antibody, Unconjugated, Clone 2B11
Price 
Description Mouse monoclonal antibody raised against a partial recombinant NFKBIB.
Immunogen: NFKBIB (AAH15528, 56 a.a. ~ 145 a.a) partial recombinant protein with GST tag.
Protein Sequence: EDGDTALHLAVIHQHEPFLDFLLGFSAGTEYMDLQNDLGQTALHLAAILGETSTVEKLYAAGAGLCVAERRGHTALHLACRVGAHACARA
Accession: BC015528
Protein Accession Number: AAH15528
OMIM: 604495,
GeneID: 4793
Lot Number: MM951100683
MA Code: ABVAP92OG
Operation Date: 2006/12/22
Info Abnova CorporationAbnova Corporation
Abnova Corporation (HQ)
9th Fl., No. 108, Jhouzih St.
Neihu District, Taipei
114 Taiwan R.O.C.
Tel: +886-2-8751-1888
Fax: +886-2-8751-1166

Abnova GmbH
Boxbergring 107
69126 Heidelberg
Germany
Tel: +49 6221 3632226
Fax: +49 6221 825878

Customer Service: +886-2-8751-1888
Fax Number: +886-2-8751-1166
Web Site: http://www.abnova.com.tw
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Mouse Anti-Amodiaquine Monoclonal Antibody, Unconjugated, Clone 6D10 from AntibodyShop A/S
2. Mouse Anti-Protein S Monoclonal Antibody, Unconjugated, Clone HYB 232-02 from Abcam
3. Mouse Anti-Mouse Glutathione S-transferase M1 (GSTM1) Monoclonal Antibody, Unconjugated from Lifespan Biosciences
4. Mouse Anti-Human S-100 alpha/beta chain Monoclonal Antibody, Unconjugated, Clone 8B10 from Santa Cruz Biotechnology, Inc.
5. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Testis from OriGene Technologies
6. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Brain (adult) from OriGene Technologies
7. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (12.5 - day) from OriGene Technologies
8. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (19 - day) from OriGene Technologies
9. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Thymus from OriGene Technologies
10. Mouse Anti-Human Complement factor B Monoclonal Antibody, Unconjugated, Clone 9B6 from AntibodyShop A/S
11. Mouse Anti-Human Choriongonadotropin (hCG) Monoclonal Antibody, Unconjugated, Clone 5F10 from AntibodyShop A/S
Mouse monoclonal to OCIL ( Abpromise for all tested applications)....
Oxidative Stress-Inducible Protein Tyrosine Phosphatase...
... GenBank Accession Number : ... (C-QSQENQDTRPKVKAKK), corresponding to amino acids ... Formulation: antiserum in 0.05% sodium ... Assurance: routinely evaluated by immunoblot ...
Antibody specific for histone H3 acetylated at any of the five N-terminal lysine residues. Rabbit polyclonal serum. Antigen: Synthetic peptide derived from histone H3 N-terminal region, mulitpliy...
Biology Products:
(Date:2/2/2016)... , Feb. 2, 2016 Technology Enhancements Accelerate ... an analysis of the digital and computed radiography markets ... , and Indonesia (TIM). ... and market size, as well as regional market drivers ... and discusses market penetration and market attractiveness, both for ...
(Date:2/1/2016)... -- Rising sales of consumer electronics coupled ... gesture control market size through ... electronics coupled with new technological advancements to drive global ... through 2020   --> Rising ... to drive global touchfree intuitive gesture control market ...
(Date:1/28/2016)... Synaptics (NASDAQ: SYNA ), a leading developer of ... ended December 31, 2015. --> ... increased 2 percent compared to the comparable quarter last year to ... was $35.0 million, or $0.93 per diluted share. ... first quarter of fiscal 2016 grew 9 percent over the prior ...
Breaking Biology News(10 mins):
(Date:2/11/2016)... Germany and GERMANTOWN, ... QGEN ; Frankfurt Prime Standard: QIA) today announced ... RNA Panels for gene expression profiling, expanding QIAGEN,s portfolio ... The panels enable researchers to select from over 20,000 ... and discover interactions between genes, cellular phenotypes and disease ...
(Date:2/11/2016)... , Feb. 11, 2016  Dovetail Genomics™ LLC ... its beta program for a planned metagenomic genome assembly ... the company,s metagenomic genome assembly method in a talk ... Genome Biology & Technology conference in Orlando, ... these highly complex datasets is difficult. Using its proprietary ...
(Date:2/11/2016)... ... February 11, 2016 , ... Global Stem ... clinic in Quito, Ecuador. The new facility will provide advanced protocols and state-of-the-art ... around the world. , The new GSCG clinic is headed by four ...
(Date:2/10/2016)... 2016 ASAE is introducing a hybrid membership ... (AMC) the option of joining or renewing through an ... by staff size, every employee in any size association ... reap all available member benefits.   John ... membership options will allow organizations of any size and ...
Breaking Biology Technology: