Navigation Links
Mouse Anti-NFKBIB Monoclonal Antibody, Unconjugated, Clone 2B11 from Abnova Corporation

ProductsMouse Anti-NFKBIB Monoclonal Antibody, Unconjugated, Clone 2B11 from Abnova Corporation
Company Abnova Corporation
Item Mouse Anti-NFKBIB Monoclonal Antibody, Unconjugated, Clone 2B11
Price 
Description Mouse monoclonal antibody raised against a partial recombinant NFKBIB.
Immunogen: NFKBIB (AAH15528, 56 a.a. ~ 145 a.a) partial recombinant protein with GST tag.
Protein Sequence: EDGDTALHLAVIHQHEPFLDFLLGFSAGTEYMDLQNDLGQTALHLAAILGETSTVEKLYAAGAGLCVAERRGHTALHLACRVGAHACARA
Accession: BC015528
Protein Accession Number: AAH15528
OMIM: 604495,
GeneID: 4793
Lot Number: MM951100683
MA Code: ABVAP92OG
Operation Date: 2006/12/22
Info Abnova CorporationAbnova Corporation
Abnova Corporation (HQ)
9th Fl., No. 108, Jhouzih St.
Neihu District, Taipei
114 Taiwan R.O.C.
Tel: +886-2-8751-1888
Fax: +886-2-8751-1166

Abnova GmbH
Boxbergring 107
69126 Heidelberg
Germany
Tel: +49 6221 3632226
Fax: +49 6221 825878

Customer Service: +886-2-8751-1888
Fax Number: +886-2-8751-1166
Web Site: http://www.abnova.com.tw
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Mouse Anti-Amodiaquine Monoclonal Antibody, Unconjugated, Clone 6D10 from AntibodyShop A/S
2. Mouse Anti-Protein S Monoclonal Antibody, Unconjugated, Clone HYB 232-02 from Abcam
3. Mouse Anti-Mouse Glutathione S-transferase M1 (GSTM1) Monoclonal Antibody, Unconjugated from Lifespan Biosciences
4. Mouse Anti-Human S-100 alpha/beta chain Monoclonal Antibody, Unconjugated, Clone 8B10 from Santa Cruz Biotechnology, Inc.
5. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Testis from OriGene Technologies
6. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Brain (adult) from OriGene Technologies
7. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (12.5 - day) from OriGene Technologies
8. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (19 - day) from OriGene Technologies
9. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Thymus from OriGene Technologies
10. Mouse Anti-Human Complement factor B Monoclonal Antibody, Unconjugated, Clone 9B6 from AntibodyShop A/S
11. Mouse Anti-Human Choriongonadotropin (hCG) Monoclonal Antibody, Unconjugated, Clone 5F10 from AntibodyShop A/S
...
... Polymerase gene from Thermus aquaticus (strain ... E. coli, then highly purified to ... used in the amplification and sequence ... quality of the Taq DNA polymerase ...
Rabbit polyclonal to hnRNP-U...
... DNase I (RNase-free) (E.C. 3.1.21.1) is a ... and chromatin. It functions by hydrolyzing phosphodiester ... 5'-phosphate and a 3'-hydroxyl group. Ambion's RNase-free ... available and is recommended to degrade DNA ...
Biology Products:
(Date:7/10/2014)... major cities in New Mexico, nearly every public golf ... than precious potable water supplies. Across the U.S. Southwest ... courses receive treated effluent. Reusing the effluent increases the ... and homeowners alike fertilize their lawns during the growing ... New Mexico State University turfgrass expert has a new ...
(Date:7/10/2014)... 27, 2014  Pomerantz LLP has filed a ... or the "Company")(NYSE-MKT: PVCT) and certain of its ... District Court, Middle District of Tennessee ... a class consisting of all persons or entities ... December 17, 2013 and May 22, 2014, both ...
(Date:7/10/2014)... , July 1, 2014 Smart technology ... for convenience and improved security: NXT-ID, Inc. (OTCBB: NXTD), eBay ... GOOG ), Apple Inc. (NASDAQ: AAPL ), ... (NYSE: MA) NXT-ID, Inc., (OTCQB: NXTD) a biometric authentication ... announce that the second series of 30 second spots on ...
Breaking Biology News(10 mins):'Tailored' water -- the latest in lawn care 2SHAREHOLDER ALERT: Pomerantz Law Firm Announces the Filing of a Class Action against Provectus Biopharmaceuticals, Inc. and Certain Officers - PVCT 2SHAREHOLDER ALERT: Pomerantz Law Firm Announces the Filing of a Class Action against Provectus Biopharmaceuticals, Inc. and Certain Officers - PVCT 3Advantages for Digital Wallets Eliminate Need to Carry Credit Cards - Large Scale CNBC Ad Campaign for Latest Smart Wallet to Commence July 7th 2Advantages for Digital Wallets Eliminate Need to Carry Credit Cards - Large Scale CNBC Ad Campaign for Latest Smart Wallet to Commence July 7th 3Advantages for Digital Wallets Eliminate Need to Carry Credit Cards - Large Scale CNBC Ad Campaign for Latest Smart Wallet to Commence July 7th 4Advantages for Digital Wallets Eliminate Need to Carry Credit Cards - Large Scale CNBC Ad Campaign for Latest Smart Wallet to Commence July 7th 5
... Waltham, Mass.How does inflammation, brought on by stress, affect aging? ... and economic crisis of an epidemic of neurologic diseases caused ... manage to keep a rosy outlook in the face of ... and a host of other questions are the focus of ...
... The Howard Hughes Medical Research Institute today announced that ... among 50 scientists nationwide to be appointed HHMI Early ... associate member of the Center,s Basic Sciences Division, and ... Center,s Human Biology and Public Health Sciences divisions, each ...
... 26, 2009 / b3c newswire / -Companies are using ... as a platform to launch new products. Under the ... discuss important topics such as KAM, value proposition and ... pressure in this fast changing landscape.  , Randi Altschul, ...
Cached Biology News:Living long, living well 2Two Hutchinson Center researchers named HHMI Early Career Scientists 2
(Date:7/11/2014)... Research ( http://www.bccresearch.com ) reveals in its new report, ... MARKETS , the global market for digital polymerase chain ... This is estimated to grow to $490 billion in ... of 28.6%. , New digital PCR technology has created ... broader PCR field. The opportunities presented by this technology ...
(Date:7/11/2014)... (PRWEB) July 11, 2014 Cayenne ... company specializing in the soft tissue reconstruction segment, ... Anchor System for surgeries involving the shoulder and ... through a novel, inserter-controlled deployment method. The unique ... partial deployment, anchor pull-out, or anchor displacement (also ...
(Date:7/10/2014)... Understanding the need for better quality ... the gap that currently exists in this area, ChanTest ... portfolio of validated ion channel and GPCR cell lines. ... as ion channels control many critical physiological functions throughout ... the potential to treat a variety of human diseases. ...
(Date:7/10/2014)... CA (PRWEB) July 10, 2014 OMICS ... Bioanalytical techniques during 18-20 August, 2014 at Double Tree ... review the recent developments in Analytical & Bioanalytical research ... globe. , Speaking on this occasion, Dr. Srinubabu Gedela, ... Analytica Acta conference is a remarkable one in bringing ...
Breaking Biology Technology:Global Market for Digital Polymerase Chain Reaction Technology to Reach $490 Billion by 2018; Equipment Sector Accounts for the Fastest Growing Segment With 33% CAGR 2Global Market for Digital Polymerase Chain Reaction Technology to Reach $490 Billion by 2018; Equipment Sector Accounts for the Fastest Growing Segment With 33% CAGR 3Cayenne Medical Launches SureLock™ All-Suture Anchor System for Shoulder and Extremity Surgery 2Cayenne Medical Launches SureLock™ All-Suture Anchor System for Shoulder and Extremity Surgery 3Leader in Ion Channel Research Announces Newly Validated and Re-Engineered Cells 2Leader in Ion Channel Research Announces Newly Validated and Re-Engineered Cells 3A Critical Review of Analytical Techniques for Improved Living Standards 2A Critical Review of Analytical Techniques for Improved Living Standards 3A Critical Review of Analytical Techniques for Improved Living Standards 4