Navigation Links
Mouse Anti-NFKBIB Monoclonal Antibody, Unconjugated, Clone 2B11 from Abnova Corporation

ProductsMouse Anti-NFKBIB Monoclonal Antibody, Unconjugated, Clone 2B11 from Abnova Corporation
Company Abnova Corporation
Item Mouse Anti-NFKBIB Monoclonal Antibody, Unconjugated, Clone 2B11
Price 
Description Mouse monoclonal antibody raised against a partial recombinant NFKBIB.
Immunogen: NFKBIB (AAH15528, 56 a.a. ~ 145 a.a) partial recombinant protein with GST tag.
Protein Sequence: EDGDTALHLAVIHQHEPFLDFLLGFSAGTEYMDLQNDLGQTALHLAAILGETSTVEKLYAAGAGLCVAERRGHTALHLACRVGAHACARA
Accession: BC015528
Protein Accession Number: AAH15528
OMIM: 604495,
GeneID: 4793
Lot Number: MM951100683
MA Code: ABVAP92OG
Operation Date: 2006/12/22
Info Abnova CorporationAbnova Corporation
Abnova Corporation (HQ)
9th Fl., No. 108, Jhouzih St.
Neihu District, Taipei
114 Taiwan R.O.C.
Tel: +886-2-8751-1888
Fax: +886-2-8751-1166

Abnova GmbH
Boxbergring 107
69126 Heidelberg
Germany
Tel: +49 6221 3632226
Fax: +49 6221 825878

Customer Service: +886-2-8751-1888
Fax Number: +886-2-8751-1166
Web Site: http://www.abnova.com.tw
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Mouse Anti-Amodiaquine Monoclonal Antibody, Unconjugated, Clone 6D10 from AntibodyShop A/S
2. Mouse Anti-Protein S Monoclonal Antibody, Unconjugated, Clone HYB 232-02 from Abcam
3. Mouse Anti-Mouse Glutathione S-transferase M1 (GSTM1) Monoclonal Antibody, Unconjugated from Lifespan Biosciences
4. Mouse Anti-Human S-100 alpha/beta chain Monoclonal Antibody, Unconjugated, Clone 8B10 from Santa Cruz Biotechnology, Inc.
5. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Testis from OriGene Technologies
6. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Brain (adult) from OriGene Technologies
7. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (12.5 - day) from OriGene Technologies
8. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (19 - day) from OriGene Technologies
9. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Thymus from OriGene Technologies
10. Mouse Anti-Human Complement factor B Monoclonal Antibody, Unconjugated, Clone 9B6 from AntibodyShop A/S
11. Mouse Anti-Human Choriongonadotropin (hCG) Monoclonal Antibody, Unconjugated, Clone 5F10 from AntibodyShop A/S
When added to either StemSep CD4+ or CD8+ T Cell Enrichment cocktails, human HLA-DR TAC is designed to deplete human HLA-DR from samples to isolate resting CD4+ or CD8+ T cells....
lid holder -see Blotters (Semi-Dry) for more info...
... The Fujifilm Life Science BAS-5000 ... all Imaging Plate equipment. The top ... scanners, it features a superior Imaging ... for versatility in target subjects. Fujifilm ...
... the consumable measurement plate for ... individually controlled measurement sites. Each ... liquid flow channel system that ... solution and compound applications necessary ...
Biology Products:
(Date:1/4/2017)... 2017  For the thousands of attendees at this year,s International Consumer ... health and biometric measurement devices and services, will be featuring its new ... in A&D Medical,s special CES Exhibit Suite , the new upper ... the company,s WellnessConnected product platform.  ... ...
(Date:1/3/2017)... 2017 Onitor, provider of digital health technology ... an innovative biometric data-driven program designed to aid weight ... the 2017 Consumer Electronics Show (CES) in ... U.S., the World Health Organization (WHO), have identified lifestyle ... who are overweight or obese. WHO also states that ...
(Date:12/22/2016)... , December 22, 2016 SuperCom (NASDAQ: ... secure solutions for the e-Government, Public Safety, HealthCare, and Finance sectors ... SuperCom, has been selected to implement and deploy a community-based supportive ... Northern California , further expanding its presence in the ... This new ...
Breaking Biology News(10 mins):
(Date:1/17/2017)... , Jan. 17, 2017 The ... at a CAGR of around 7.5% over the ... 2025. Some of the prominent trends that the ... incidences of diseases & graft transplant surgeries and ... Material the market is categorized into immunomodulatory biomaterials, ...
(Date:1/17/2017)... 17, 2017   Pulmatrix, Inc . (NASDAQ: ... innovative inhaled therapies to address serious pulmonary diseases, today ... in the lungs of CF patients, PUR1900, has been ... the U.S. Food & Drug Administration. Under ... speed the development of novel drugs against important pathogens, ...
(Date:1/17/2017)...  Northwell Health today announced a collaboration with ... research. As New ... Northwell Health diagnoses and treats 19,000 new cancer ... Germany -based oncology research company working ... greatly expand cancer biobanking activities within Northwell Health ...
(Date:1/17/2017)... ... January 17, 2017 , ... NeoTrident, a leading provider ... and performance management systems for high-consequence industries, announced today that they have entered ... sciences industry, organizations must pay much more attention to the quality of products ...
Breaking Biology Technology: