Navigation Links
Mouse Anti-NFKBIB Monoclonal Antibody, Unconjugated, Clone 2B11 from Abnova Corporation

ProductsMouse Anti-NFKBIB Monoclonal Antibody, Unconjugated, Clone 2B11 from Abnova Corporation
Company Abnova Corporation
Item Mouse Anti-NFKBIB Monoclonal Antibody, Unconjugated, Clone 2B11
Price 
Description Mouse monoclonal antibody raised against a partial recombinant NFKBIB.
Immunogen: NFKBIB (AAH15528, 56 a.a. ~ 145 a.a) partial recombinant protein with GST tag.
Protein Sequence: EDGDTALHLAVIHQHEPFLDFLLGFSAGTEYMDLQNDLGQTALHLAAILGETSTVEKLYAAGAGLCVAERRGHTALHLACRVGAHACARA
Accession: BC015528
Protein Accession Number: AAH15528
OMIM: 604495,
GeneID: 4793
Lot Number: MM951100683
MA Code: ABVAP92OG
Operation Date: 2006/12/22
Info Abnova CorporationAbnova Corporation
Abnova Corporation (HQ)
9th Fl., No. 108, Jhouzih St.
Neihu District, Taipei
114 Taiwan R.O.C.
Tel: +886-2-8751-1888
Fax: +886-2-8751-1166

Abnova GmbH
Boxbergring 107
69126 Heidelberg
Germany
Tel: +49 6221 3632226
Fax: +49 6221 825878

Customer Service: +886-2-8751-1888
Fax Number: +886-2-8751-1166
Web Site: http://www.abnova.com.tw
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Mouse Anti-Amodiaquine Monoclonal Antibody, Unconjugated, Clone 6D10 from AntibodyShop A/S
2. Mouse Anti-Protein S Monoclonal Antibody, Unconjugated, Clone HYB 232-02 from Abcam
3. Mouse Anti-Mouse Glutathione S-transferase M1 (GSTM1) Monoclonal Antibody, Unconjugated from Lifespan Biosciences
4. Mouse Anti-Human S-100 alpha/beta chain Monoclonal Antibody, Unconjugated, Clone 8B10 from Santa Cruz Biotechnology, Inc.
5. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Testis from OriGene Technologies
6. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Brain (adult) from OriGene Technologies
7. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (12.5 - day) from OriGene Technologies
8. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (19 - day) from OriGene Technologies
9. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Thymus from OriGene Technologies
10. Mouse Anti-Human Complement factor B Monoclonal Antibody, Unconjugated, Clone 9B6 from AntibodyShop A/S
11. Mouse Anti-Human Choriongonadotropin (hCG) Monoclonal Antibody, Unconjugated, Clone 5F10 from AntibodyShop A/S
Mouse monoclonal [164-12-2] to Ampicillin ( Abpromise for all tested applications)....
... product contains 5 ml Dynabeads Epoxy (4.5 ... ether (epoxy) reactive groups. Ideal for coupling ... absorbed hydrophobically on initial coupling with covalent ... and sulphydryll groups (SH)) occurring within ...
... Normal;heading 1;heading ... types and experimental ... for standard transfection ... transduction systems. ViraPower ...
...
Biology Products:
(Date:8/17/2018)... ... , ... With increasing safety requirements, and time and financial pressure, the development ... To be successful in such a competitive environment, it is more important than ever ... needed to develop a new drug or to execute fundamental research. , In ...
(Date:8/15/2018)... ... August 15, 2018 , ... The Florida Chiropractic Association’s National Meeting ... Doctors from around the U.S. will gain firsthand insights into the new laser’s ... completed another successful clinical trial that has resulted in the granting of an ...
(Date:8/14/2018)... ... August 13, 2018 , ... Castle Dental® has partnered ... office on South Lamar Blvd. to provide free dental services for underinsured, low-income ... include x-rays and exams, fillings , extractions , cleanings ...
Breaking Biology News(10 mins):
(Date:7/26/2018)... CALGARY, Canada (PRWEB) , ... July 26, 2018 ... ... research results based on the impact of a biofield energy treated nutraceutical to ... as well as, immune function response assessed in the preclinical research, were significantly ...
(Date:7/25/2018)... ... July 25, 2018 , ... We are pleased to ... York’s (FCNY) acquisition of several Erchonia low-level lasers, including both Lunula Lasers and ... clinical experience. Their students receive comprehensive academic training and directly-supervised clinical experiences ...
(Date:7/24/2018)... ... 24, 2018 , ... R3 Stem Cell is now offering regenerative therapies for ... by Double Board Certified providers, with outcomes significantly improving patient quality of life. , ... done nothing to help repair and regenerate damaged lung tissues. Stem cell therapy ...
(Date:7/22/2018)... ... July 19, 2018 , ... ... partnership agreement with Essex Bio-Investment for Phase 3 clinical program in Dry Eye ... lead compound SkQ1 with approximately $17m allocated towards the first Phase 3 study ...
Breaking Biology Technology: