Navigation Links
Mouse Anti-MAK Monoclonal Antibody, Unconjugated, Clone 4E9 from Abnova Corporation

ProductsMouse Anti-MAK Monoclonal Antibody, Unconjugated, Clone 4E9 from Abnova Corporation
Company Abnova Corporation
Item Mouse Anti-MAK Monoclonal Antibody, Unconjugated, Clone 4E9
Price 
Description Mouse monoclonal antibody raised against a partial recombinant MAK.
Immunogen: MAK (AAH39825, 358 a.a. ~ 457 a.a) partial recombinant protein with GST tag.
Protein Sequence: PPKQQSQEKPPQTLFPSIVKNMPTKPNGTLSHKSGRRRWGQTIFKSGDSWEELEDYDFGASHSKKPSMGVFKEKRKKDSPFRQQVKMAVISLSAHQFPTL
Accession: BC039825
Protein Accession Number: AAH39825
OMIM: 154235,
GeneID: 4117
Lot Number: MM951100652
MA Code: ABVAP914S
Operation Date: 2006/12/22
Info Abnova CorporationAbnova Corporation
Abnova Corporation (HQ)
9th Fl., No. 108, Jhouzih St.
Neihu District, Taipei
114 Taiwan R.O.C.
Tel: +886-2-8751-1888
Fax: +886-2-8751-1166

Abnova GmbH
Boxbergring 107
69126 Heidelberg
Germany
Tel: +49 6221 3632226
Fax: +49 6221 825878

Customer Service: +886-2-8751-1888
Fax Number: +886-2-8751-1166
Web Site: http://www.abnova.com.tw
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Mouse Anti-Amodiaquine Monoclonal Antibody, Unconjugated, Clone 6D10 from AntibodyShop A/S
2. Mouse Anti-Protein S Monoclonal Antibody, Unconjugated, Clone HYB 232-02 from Abcam
3. Mouse Anti-Mouse Glutathione S-transferase M1 (GSTM1) Monoclonal Antibody, Unconjugated from Lifespan Biosciences
4. Mouse Anti-Human S-100 alpha/beta chain Monoclonal Antibody, Unconjugated, Clone 8B10 from Santa Cruz Biotechnology, Inc.
5. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Testis from OriGene Technologies
6. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Brain (adult) from OriGene Technologies
7. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (12.5 - day) from OriGene Technologies
8. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (19 - day) from OriGene Technologies
9. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Thymus from OriGene Technologies
10. Mouse Anti-Human Complement factor B Monoclonal Antibody, Unconjugated, Clone 9B6 from AntibodyShop A/S
11. Mouse Anti-Human Choriongonadotropin (hCG) Monoclonal Antibody, Unconjugated, Clone 5F10 from AntibodyShop A/S
... Jouan MSC series of Class II ... conditions and certification to the world's ... ensures that the cabinets cannot be ... Natural lighting, low noise and arm ...
... Fluoroskan Ascent is a dedicated ... for all kinds of assays ... and for clinical applications. Cell ... are all important application areas. ...
... A sleek design loaded with class-leading features, the ... that your work is safe and consistent every time ... the new 1400 Series reduces power consumption by as ... of dollars over the life of the cabinet. ...
... The Magnetic Stand-96 is designed for paramagnetic ... and 0.2 ml PCR plates with no ... polyacryl base in a standard SBS 96-well ... strong permanent magnets guarantees easy and fast ...
Biology Products:
(Date:9/19/2014)... Jimmy Durante of dinosaurs a newly discovered ... new dinosaur, named Rhinorex condrupus by ... Young University, lived in what is now Utah ... Cretaceous period. , Rhinorex, which translates roughly into ... relative of other Cretaceous hadrosaurs like Parasaurolophus and ...
(Date:9/19/2014)... today by researchers from several Harvard University labs ... experienced and aspiring researchers with the intellectual raw ... made from soft, flexible materials. , With the ... other advances in manufacturing technology, soft robotics is ... drawn from conventional rigid robot design, but working ...
(Date:9/19/2014)... the unique bioelectric signaling system of the electric fish, ... The OU researcher is working to understand how these ... used to map the world around them. Electric ... discharges a second throughout their lives. The energetic ... necessary for survival. , "There is evidence that electric ...
Breaking Biology News(10 mins):New hadrosaur noses into spotlight 2Soft robotics 'toolkit' features everything a robot-maker needs 2
... (SALT LAKE CITY)Alternating hemiplegia of childhood (AHC) is a ... episodes of paralysis and stiffness, first affecting one side ... and disappear, again and again, and affected children often ... older, children fall progressively behind their peers in both ...
... smog-filled sky or a contaminated river, according to a ... for the prosperous. People living in China,s cities ... more likely to begreen: re-using their plastic grocery bags ... the international journal AMBIO , indicates that the ...
... doesn,t mean making a trip to the local pharmacy for ... the forest to provide a pharmacopeia of medicines to ... But while questions persist about whether such natural remedies are ... examining the phenomenon from a unique perspective, and trying to ...
Cached Biology News:Gene mutations linked to most cases of rare disorder -- Alternating Hemoplegia of Childhood 2Gene mutations linked to most cases of rare disorder -- Alternating Hemoplegia of Childhood 3Pollution can make citizens - both rich and poor - go green 2Health care savings, naturally 2Health care savings, naturally 3
(Date:9/19/2014)... Life is rarely simple. From crop yields to disease ... usually those considered "complex traits." Just as for heightthe ... a particular human disease are shaped by multiple genetic ... genes involved. To track down such genes, geneticists typically ... a large mouse and a small mouseand then study ...
(Date:9/19/2014)... YORK, September 18, 2014 Scientists at NYU Langone ... dramatically the efficiency of the process for turning adult ... well-known compounds, including vitamin C. Using the new technique ... cells obtained from adult skin cells by more than ... technique is efficient and reliable, and thus should generally ...
(Date:9/19/2014)... that use light, rather than electricity, to move ... energy efficiency is a growing concern as chips, ... components of optical circuits light emitters, modulators, ... build. One promising light source for optical chips ... properties when deposited as a single, atom-thick layer. ...
(Date:9/19/2014)... September 19, 2014 Follow ... potential to revolutionize the world has attracted diverse ... and small start-ups. The early years of nanotechnology ... largely due to the high risks involved, which ... earmarked for this evolving technology have been growing ...
Breaking Biology Technology:Want to link genes to complex traits? Start with more diversity 2NYU Langone scientists report reliable and highly efficient method for making stem cells 2NYU Langone scientists report reliable and highly efficient method for making stem cells 3Toward optical chips 2Toward optical chips 3Growing R&D Investments & Developments in Nanomaterials to Drive the Global Nanotechnology Market, According to New Report by Global Industry Analysts, Inc. 2Growing R&D Investments & Developments in Nanomaterials to Drive the Global Nanotechnology Market, According to New Report by Global Industry Analysts, Inc. 3Growing R&D Investments & Developments in Nanomaterials to Drive the Global Nanotechnology Market, According to New Report by Global Industry Analysts, Inc. 4