Navigation Links
Mouse Anti-MAK Monoclonal Antibody, Unconjugated, Clone 4E9 from Abnova Corporation

ProductsMouse Anti-MAK Monoclonal Antibody, Unconjugated, Clone 4E9 from Abnova Corporation
Company Abnova Corporation
Item Mouse Anti-MAK Monoclonal Antibody, Unconjugated, Clone 4E9
Price 
Description Mouse monoclonal antibody raised against a partial recombinant MAK.
Immunogen: MAK (AAH39825, 358 a.a. ~ 457 a.a) partial recombinant protein with GST tag.
Protein Sequence: PPKQQSQEKPPQTLFPSIVKNMPTKPNGTLSHKSGRRRWGQTIFKSGDSWEELEDYDFGASHSKKPSMGVFKEKRKKDSPFRQQVKMAVISLSAHQFPTL
Accession: BC039825
Protein Accession Number: AAH39825
OMIM: 154235,
GeneID: 4117
Lot Number: MM951100652
MA Code: ABVAP914S
Operation Date: 2006/12/22
Info Abnova CorporationAbnova Corporation
Abnova Corporation (HQ)
9th Fl., No. 108, Jhouzih St.
Neihu District, Taipei
114 Taiwan R.O.C.
Tel: +886-2-8751-1888
Fax: +886-2-8751-1166

Abnova GmbH
Boxbergring 107
69126 Heidelberg
Germany
Tel: +49 6221 3632226
Fax: +49 6221 825878

Customer Service: +886-2-8751-1888
Fax Number: +886-2-8751-1166
Web Site: http://www.abnova.com.tw
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Mouse Anti-Amodiaquine Monoclonal Antibody, Unconjugated, Clone 6D10 from AntibodyShop A/S
2. Mouse Anti-Protein S Monoclonal Antibody, Unconjugated, Clone HYB 232-02 from Abcam
3. Mouse Anti-Mouse Glutathione S-transferase M1 (GSTM1) Monoclonal Antibody, Unconjugated from Lifespan Biosciences
4. Mouse Anti-Human S-100 alpha/beta chain Monoclonal Antibody, Unconjugated, Clone 8B10 from Santa Cruz Biotechnology, Inc.
5. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Testis from OriGene Technologies
6. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Brain (adult) from OriGene Technologies
7. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (12.5 - day) from OriGene Technologies
8. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (19 - day) from OriGene Technologies
9. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Thymus from OriGene Technologies
10. Mouse Anti-Human Complement factor B Monoclonal Antibody, Unconjugated, Clone 9B6 from AntibodyShop A/S
11. Mouse Anti-Human Choriongonadotropin (hCG) Monoclonal Antibody, Unconjugated, Clone 5F10 from AntibodyShop A/S
Formulation: Phosphate-buffered saline, pH 7.2, containing 0.09% sodium azide....
Mouse monoclonal [0.T.81] to Lac1 ( Abpromise for all tested applications). Antigen: Recombinant TrpE fusion protein containing full length E. coli Lac1....
Polyclonal Antibody to HADHB...
EDG-6 Lysate Source: Cell Lysate Application: Western Blotting Control Form: IgG...
Biology Products:
(Date:5/6/2017)... , May 5, 2017 RAM ... announced a new breakthrough in biometric authentication based ... quantum mechanical properties to perform biometric authentication. These new ... semiconductor material created by Ram Group and its ... entertainment, transportation, supply chains and security. Ram Group ...
(Date:4/13/2017)... SANTA MONICA, Calif. , April 13, 2017 /PRNewswire/ ... New York will feature emerging and ... Innovation Summits. Both Innovation Summits will run alongside the ... variety of speaker sessions, panels and demonstrations focused on ... east coast,s largest advanced design and manufacturing event will ...
(Date:4/11/2017)... April 11, 2017 NXT-ID, Inc. (NASDAQ: ... company, announces the appointment of independent Directors Mr. Robin ... its Board of Directors, furthering the company,s corporate governance and ... Gino Pereira ... look forward to their guidance and benefiting from their considerable ...
Breaking Biology News(10 mins):
(Date:7/20/2017)... ... , ... Dr. Asher Kimchi, Founder and Chairman of the International Academy ... the 22nd World Congress on Heart Disease held in Vancouver, BC, Canada. In addition ... Fellowship Awards. , Dr. Asher Kimchi, together with Co-Chairmen Dr. John A. Elefteriades and ...
(Date:7/20/2017)... (PRWEB) , ... July 20, 2017 , ... Corporate Directors ... at its 27th annual Director of the Year Awards. , The awards will be ... Jolla. This annual event celebrates directors who have made significantly positive contributions in ...
(Date:7/18/2017)... ... July 18, 2017 , ... G-CON ... Patent and Trademark Office for its Patent Applications 14/858,857 and 13/669,785 both entitled ... these patent applications further expand the protection of G-CON’s R&D investments and validate ...
(Date:7/17/2017)... IN (PRWEB) , ... July 17, 2017 , ... The ... The local celebration of National Model Aviation Day will take place from 9 a.m. ... free and will include activities for all ages. , Aviation Adventure Day will be ...
Breaking Biology Technology: