Navigation Links
Mouse Anti-MAK Monoclonal Antibody, Unconjugated, Clone 4E9 from Abnova Corporation

ProductsMouse Anti-MAK Monoclonal Antibody, Unconjugated, Clone 4E9 from Abnova Corporation
Company Abnova Corporation
Item Mouse Anti-MAK Monoclonal Antibody, Unconjugated, Clone 4E9
Price 
Description Mouse monoclonal antibody raised against a partial recombinant MAK.
Immunogen: MAK (AAH39825, 358 a.a. ~ 457 a.a) partial recombinant protein with GST tag.
Protein Sequence: PPKQQSQEKPPQTLFPSIVKNMPTKPNGTLSHKSGRRRWGQTIFKSGDSWEELEDYDFGASHSKKPSMGVFKEKRKKDSPFRQQVKMAVISLSAHQFPTL
Accession: BC039825
Protein Accession Number: AAH39825
OMIM: 154235,
GeneID: 4117
Lot Number: MM951100652
MA Code: ABVAP914S
Operation Date: 2006/12/22
Info Abnova CorporationAbnova Corporation
Abnova Corporation (HQ)
9th Fl., No. 108, Jhouzih St.
Neihu District, Taipei
114 Taiwan R.O.C.
Tel: +886-2-8751-1888
Fax: +886-2-8751-1166

Abnova GmbH
Boxbergring 107
69126 Heidelberg
Germany
Tel: +49 6221 3632226
Fax: +49 6221 825878

Customer Service: +886-2-8751-1888
Fax Number: +886-2-8751-1166
Web Site: http://www.abnova.com.tw
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Mouse Anti-Amodiaquine Monoclonal Antibody, Unconjugated, Clone 6D10 from AntibodyShop A/S
2. Mouse Anti-Protein S Monoclonal Antibody, Unconjugated, Clone HYB 232-02 from Abcam
3. Mouse Anti-Mouse Glutathione S-transferase M1 (GSTM1) Monoclonal Antibody, Unconjugated from Lifespan Biosciences
4. Mouse Anti-Human S-100 alpha/beta chain Monoclonal Antibody, Unconjugated, Clone 8B10 from Santa Cruz Biotechnology, Inc.
5. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Testis from OriGene Technologies
6. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Brain (adult) from OriGene Technologies
7. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (12.5 - day) from OriGene Technologies
8. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (19 - day) from OriGene Technologies
9. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Thymus from OriGene Technologies
10. Mouse Anti-Human Complement factor B Monoclonal Antibody, Unconjugated, Clone 9B6 from AntibodyShop A/S
11. Mouse Anti-Human Choriongonadotropin (hCG) Monoclonal Antibody, Unconjugated, Clone 5F10 from AntibodyShop A/S
Recognizes the VZV nucleocapsid by indirect immunofluorescence and immunoprecipitation. Shows cross-reactivity to HSV....
Rabbit polyclonal to Orexin Prepro ( Abpromise for all tested applications). entrezGeneID: 3060 SwissProtID: O43612...
Adenylate kinase isoenzyme 6...
AK6 Antibody...
Biology Products:
(Date:3/10/2015)... NEW YORK , March 10, 2015  Continuing ... and the Unexpected, Hammacher Schlemmer introduces The Eye ... user,s identity before granting access to secure websites or ... trusted to verify travelers at international borders, the device ... 240 distinctive pattern points of the iris, converting them ...
(Date:3/10/2015)... , March 10, 2015   Tute Genomics , ... been selected by next-generation sequencing company PrimBio Research ... exome and targeted gene panel interpretation. PrimBio, ... adopted the most current technologies to support the work ... The company offers two types of exome sequencing services: ...
(Date:3/5/2015)... -- In Brazil , cloud computing is ... solutions and 42 percent planning to invest in them by ... of the companies will be investing in these solutions for ... in the region are currently opting for the private cloud ... significant attention in the coming years. This trend is in ...
Breaking Biology News(10 mins):Hammacher Schlemmer Introduces The Eye Scanning Password Authenticator 2PrimBio Research Selects Tute as Whole Exome Analysis Provider, Creating Integrated, End-to-End Solution for Next-Generation Sequencing & Data Analysis 2PrimBio Research Selects Tute as Whole Exome Analysis Provider, Creating Integrated, End-to-End Solution for Next-Generation Sequencing & Data Analysis 3Two of Every Three Brazilian Companies will have Invested in Cloud by 2015, Finds Frost & Sullivan 2Two of Every Three Brazilian Companies will have Invested in Cloud by 2015, Finds Frost & Sullivan 3Two of Every Three Brazilian Companies will have Invested in Cloud by 2015, Finds Frost & Sullivan 4
... OHWhen it comes to fresh vegetables and fruits, color ... with texture, size, and flavor, color plays an important ... marketing. In tomatoes, for example, color and color ... of yellow shoulder disorder, or YSD, a ripening disorder ...
... ages, the number of citizens moving from their own ... dramatically. These numbers are expected to continue rising. By ... expected to double to more than 71 million. Quality ... who will reside in retirement facilities. An article ...
... off infection by intestinal worms a condition that affects ... that the immune system is more versatile than has long ... avenue of exploration in the search for treatments against autoimmune ... its own tissues. The findings, reported by scientists who ...
Cached Biology News:Color test enhances tomato analyzer software 2Houseplants increase quality of life for retirement community residents 2A worm-and-mouse tale: B cells deserve more respect 2A worm-and-mouse tale: B cells deserve more respect 3
(Date:3/25/2015)... 25, 2015 Accelovance, a therapeutically focused contract ... "Best Contract Research Organization" at the upcoming Vaccine Industry ... This is the eighth consecutive year ... award, winning for "Best Contract Research Organization" in 2009, ... in 2013. "We,re excited to be a ...
(Date:3/25/2015)... Having added two International locations in Brisbane ... ITRA Global proudly announced recently the organization’s expansion into ... based in the United States, is one of the ... commercial real estate. , Saltwood International is ... exclusively advises occupiers of office space, ensuring that its ...
(Date:3/25/2015)... COLLEGE PARK, Md. , March 25, 2015 ... of two years of intense research by scientists ... University of Maryland and represent a breakthrough in ... an assistant professor in the Department of Animal & ... faculty research assistant in ANSC, successfully produced genome-edited ...
(Date:3/25/2015)... Fla. , March 25, 2015 Oxis ... cannabinoid therapy development and commercialization, announced today Oxis CEO ... on Tuesday March 31, 2015 at 4:15pm EST to ... at Oxis Biotech, Inc.     Oxis Chairman ... quarter of 2015 has been very exciting for Oxis ...
Breaking Biology Technology:Accelovance Nominated for 2015 Vaccine Industry Excellence (ViE) Awards 2International Organization Expands its Global Reach to Warsaw, Poland 2University of Maryland Researchers Successfully Produce Genome-edited Pigs Using Revolutionary Technology 2Oxis Biotech Inc. Announces Corporate Update Conference Call for March 31 2