Navigation Links
Mouse Anti-MAK Monoclonal Antibody, Unconjugated, Clone 4E9 from Abnova Corporation

ProductsMouse Anti-MAK Monoclonal Antibody, Unconjugated, Clone 4E9 from Abnova Corporation
Company Abnova Corporation
Item Mouse Anti-MAK Monoclonal Antibody, Unconjugated, Clone 4E9
Price 
Description Mouse monoclonal antibody raised against a partial recombinant MAK.
Immunogen: MAK (AAH39825, 358 a.a. ~ 457 a.a) partial recombinant protein with GST tag.
Protein Sequence: PPKQQSQEKPPQTLFPSIVKNMPTKPNGTLSHKSGRRRWGQTIFKSGDSWEELEDYDFGASHSKKPSMGVFKEKRKKDSPFRQQVKMAVISLSAHQFPTL
Accession: BC039825
Protein Accession Number: AAH39825
OMIM: 154235,
GeneID: 4117
Lot Number: MM951100652
MA Code: ABVAP914S
Operation Date: 2006/12/22
Info Abnova CorporationAbnova Corporation
Abnova Corporation (HQ)
9th Fl., No. 108, Jhouzih St.
Neihu District, Taipei
114 Taiwan R.O.C.
Tel: +886-2-8751-1888
Fax: +886-2-8751-1166

Abnova GmbH
Boxbergring 107
69126 Heidelberg
Germany
Tel: +49 6221 3632226
Fax: +49 6221 825878

Customer Service: +886-2-8751-1888
Fax Number: +886-2-8751-1166
Web Site: http://www.abnova.com.tw
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Mouse Anti-Amodiaquine Monoclonal Antibody, Unconjugated, Clone 6D10 from AntibodyShop A/S
2. Mouse Anti-Protein S Monoclonal Antibody, Unconjugated, Clone HYB 232-02 from Abcam
3. Mouse Anti-Mouse Glutathione S-transferase M1 (GSTM1) Monoclonal Antibody, Unconjugated from Lifespan Biosciences
4. Mouse Anti-Human S-100 alpha/beta chain Monoclonal Antibody, Unconjugated, Clone 8B10 from Santa Cruz Biotechnology, Inc.
5. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Testis from OriGene Technologies
6. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Brain (adult) from OriGene Technologies
7. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (12.5 - day) from OriGene Technologies
8. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (19 - day) from OriGene Technologies
9. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Thymus from OriGene Technologies
10. Mouse Anti-Human Complement factor B Monoclonal Antibody, Unconjugated, Clone 9B6 from AntibodyShop A/S
11. Mouse Anti-Human Choriongonadotropin (hCG) Monoclonal Antibody, Unconjugated, Clone 5F10 from AntibodyShop A/S
...
... rapidly and reliably amplify unknown genomic DNA ... provides hassle-free, ready-to use components, at an ... provided in each kit. The Genome Walking ... localized cloning of genomic DNA, isolating promoter ...
Protein YIPF6 (YIP1 family member 6). [Source:Uniprot/SWISSPROT;Acc:Q96EC8] Antigen: Recombinant Protein Epitope Signature Tag (PrEST)....
Collected from animals of U.S. origin.Collected from animals of U.S. origin. *Can be used in cell growth studies and immunoassays. *Sterility tested, * Mycoplasma tested upon request, *Endoto...
Biology Products:
(Date:3/15/2016)... York , March 15, 2016 ... market report published by Transparency Market Research "Digital Door Lock ... and Forecast 2015 - 2023," the global digital door lock ... 731.9 Mn in 2014 and is forecast to grow at ... Growth of micro, small and medium enterprises (MSMEs) across the ...
(Date:3/11/2016)... http://www.apimages.com ) - --> http://www.apimages.com ) - ... ( http://www.apimages.com ) - Germany . The ... refugee identity cards. DERMALOG will be unveiling this device, and a ... next week.   --> Germany . ... new refugee identity cards. DERMALOG will be unveiling this device, and ...
(Date:3/9/2016)... YORK , March 9, 2016 This ... and future states of the RNA Sequencing (RNA Seq) ... segments such as instruments, tools and reagents, data analysis, ... Analyze various segments of the RNA-Sequencing market such as ... services Identify the main factors affecting each segment and ...
Breaking Biology News(10 mins):
(Date:5/25/2016)... AZ (PRWEB) , ... May 25, 2016 , ... ... Dr. Michael Fitzmaurice recently became double board-certified in surgery and surgery of the ... 2015. Dr. Fitzmaurice is no stranger to going above and beyond in his ...
(Date:5/25/2016)... ... May 25, 2016 , ... Lady had been battling arthritis since ... ligament in her left knee. Lady’s owner Hannah sought the help of Dr Jeff ... surgeon, to repair her cruciate ligament and help with the pain of Lady’s arthritis. ...
(Date:5/24/2016)... , ... May 24, 2016 , ... Last week, Callan ... corporate executives and entrepreneurs, held The Future of San Diego Life Science event at ... Diego life science community attended the event with speakers Dr. Rich Heyman, former CEO ...
(Date:5/23/2016)... -- Zimmer Biomet Holdings, Inc. (NYSE and SIX: ZBH), a ... of Directors has approved the payment of a quarterly cash ... The cash dividend of $0.24 per share will ... of record as of the close of business on June ... of the Board of Directors and may be adjusted as ...
Breaking Biology Technology: