Navigation Links
Mouse Anti-MAK Monoclonal Antibody, Unconjugated, Clone 4E9 from Abnova Corporation

ProductsMouse Anti-MAK Monoclonal Antibody, Unconjugated, Clone 4E9 from Abnova Corporation
Company Abnova Corporation
Item Mouse Anti-MAK Monoclonal Antibody, Unconjugated, Clone 4E9
Price 
Description Mouse monoclonal antibody raised against a partial recombinant MAK.
Immunogen: MAK (AAH39825, 358 a.a. ~ 457 a.a) partial recombinant protein with GST tag.
Protein Sequence: PPKQQSQEKPPQTLFPSIVKNMPTKPNGTLSHKSGRRRWGQTIFKSGDSWEELEDYDFGASHSKKPSMGVFKEKRKKDSPFRQQVKMAVISLSAHQFPTL
Accession: BC039825
Protein Accession Number: AAH39825
OMIM: 154235,
GeneID: 4117
Lot Number: MM951100652
MA Code: ABVAP914S
Operation Date: 2006/12/22
Info Abnova CorporationAbnova Corporation
Abnova Corporation (HQ)
9th Fl., No. 108, Jhouzih St.
Neihu District, Taipei
114 Taiwan R.O.C.
Tel: +886-2-8751-1888
Fax: +886-2-8751-1166

Abnova GmbH
Boxbergring 107
69126 Heidelberg
Germany
Tel: +49 6221 3632226
Fax: +49 6221 825878

Customer Service: +886-2-8751-1888
Fax Number: +886-2-8751-1166
Web Site: http://www.abnova.com.tw
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Mouse Anti-Amodiaquine Monoclonal Antibody, Unconjugated, Clone 6D10 from AntibodyShop A/S
2. Mouse Anti-Protein S Monoclonal Antibody, Unconjugated, Clone HYB 232-02 from Abcam
3. Mouse Anti-Mouse Glutathione S-transferase M1 (GSTM1) Monoclonal Antibody, Unconjugated from Lifespan Biosciences
4. Mouse Anti-Human S-100 alpha/beta chain Monoclonal Antibody, Unconjugated, Clone 8B10 from Santa Cruz Biotechnology, Inc.
5. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Testis from OriGene Technologies
6. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Brain (adult) from OriGene Technologies
7. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (12.5 - day) from OriGene Technologies
8. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (19 - day) from OriGene Technologies
9. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Thymus from OriGene Technologies
10. Mouse Anti-Human Complement factor B Monoclonal Antibody, Unconjugated, Clone 9B6 from AntibodyShop A/S
11. Mouse Anti-Human Choriongonadotropin (hCG) Monoclonal Antibody, Unconjugated, Clone 5F10 from AntibodyShop A/S
MOUSE ANTI NEUROFILAMENTS 140+160 KD...
EGTA, 50 g. Ethylene glycol-O,O-bis-[2-amino-ethyl]-N,N,N,N,-tetraacetic acid.Assay: > 99.0%. Category: Nucleotides & Enzymes & Biochemicals, Ultrapure Biochemicals ....
MOUSE ANTI HUMAN COMPLEMENT SC5B-9...
Human VEGF R Phycoerythrin Sampler (Cl 89106, 49560, 54733)...
Biology Products:
(Date:6/14/2017)... 15, 2017  IBM (NYSE: IBM ) is introducing several ... dedicated to developing collaboration between startups and global businesses, taking ... During the event, nine startups will showcase the solutions they ... industries. France is ... with a 30 percent increase in the number of startups ...
(Date:5/16/2017)... 16, 2017  Veratad Technologies, LLC ( www.veratad.com ), ... and identity verification solutions, announced today they will participate ... May 15 thru May 17, 2017, in ... Trade Center. Identity impacts the lives ... today,s quickly evolving digital world, defining identity is critical ...
(Date:5/6/2017)... RAM Group , Singaporean based ... in biometric authentication based on a novel  ... to perform biometric authentication. These new sensors are based on ... Ram Group and its partners. This sensor will have ... and security. Ram Group is a next generation ...
Breaking Biology News(10 mins):
(Date:10/12/2017)... ca (PRWEB) , ... October 12, 2017 , ... ... the Surgical Wound Market with the addition of its newest module, US Hemostats ... $1.2B market for thrombin hemostats, absorbable hemostats, fibrin sealants, synthetic sealants and biologic ...
(Date:10/12/2017)... San Diego, CA (PRWEB) , ... ... ... BioInformatics (https://www.onramp.bio/ ) has launched Rosalindâ„¢, the first-ever genomics analysis platform ... eliminating all bioinformatics complexity. Named in honor of pioneering researcher Rosalind Franklin, ...
(Date:10/11/2017)... , ... October 11, 2017 , ... ... gene in its endogenous context, enabling overexpression experiments and avoiding the use of ... small RNA guides is transformative for performing systematic gain-of-function studies. , This ...
(Date:10/11/2017)... Palo Alto, CA, USA (PRWEB) , ... October 11, 2017 , ... ... is set to take place on 7th and 8th June 2018 in San Francisco, ... and policy influencers as well as several distinguished CEOs, board directors and government officials ...
Breaking Biology Technology: