Navigation Links
Mouse Anti-MAK Monoclonal Antibody, Unconjugated, Clone 4E9 from Abnova Corporation

ProductsMouse Anti-MAK Monoclonal Antibody, Unconjugated, Clone 4E9 from Abnova Corporation
Company Abnova Corporation
Item Mouse Anti-MAK Monoclonal Antibody, Unconjugated, Clone 4E9
Price 
Description Mouse monoclonal antibody raised against a partial recombinant MAK.
Immunogen: MAK (AAH39825, 358 a.a. ~ 457 a.a) partial recombinant protein with GST tag.
Protein Sequence: PPKQQSQEKPPQTLFPSIVKNMPTKPNGTLSHKSGRRRWGQTIFKSGDSWEELEDYDFGASHSKKPSMGVFKEKRKKDSPFRQQVKMAVISLSAHQFPTL
Accession: BC039825
Protein Accession Number: AAH39825
OMIM: 154235,
GeneID: 4117
Lot Number: MM951100652
MA Code: ABVAP914S
Operation Date: 2006/12/22
Info Abnova CorporationAbnova Corporation
Abnova Corporation (HQ)
9th Fl., No. 108, Jhouzih St.
Neihu District, Taipei
114 Taiwan R.O.C.
Tel: +886-2-8751-1888
Fax: +886-2-8751-1166

Abnova GmbH
Boxbergring 107
69126 Heidelberg
Germany
Tel: +49 6221 3632226
Fax: +49 6221 825878

Customer Service: +886-2-8751-1888
Fax Number: +886-2-8751-1166
Web Site: http://www.abnova.com.tw
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Mouse Anti-Amodiaquine Monoclonal Antibody, Unconjugated, Clone 6D10 from AntibodyShop A/S
2. Mouse Anti-Protein S Monoclonal Antibody, Unconjugated, Clone HYB 232-02 from Abcam
3. Mouse Anti-Mouse Glutathione S-transferase M1 (GSTM1) Monoclonal Antibody, Unconjugated from Lifespan Biosciences
4. Mouse Anti-Human S-100 alpha/beta chain Monoclonal Antibody, Unconjugated, Clone 8B10 from Santa Cruz Biotechnology, Inc.
5. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Testis from OriGene Technologies
6. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Brain (adult) from OriGene Technologies
7. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (12.5 - day) from OriGene Technologies
8. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (19 - day) from OriGene Technologies
9. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Thymus from OriGene Technologies
10. Mouse Anti-Human Complement factor B Monoclonal Antibody, Unconjugated, Clone 9B6 from AntibodyShop A/S
11. Mouse Anti-Human Choriongonadotropin (hCG) Monoclonal Antibody, Unconjugated, Clone 5F10 from AntibodyShop A/S
... porcine) Endogenous potent vasoconstrictor peptide. ... and modulates vascular tonus. ET-1, ET-2, and ... endothelin genes. ET-2 and ET-3 are similar ... six amino acids, respectively. All three isopeptides ...
... provide two highly efficient methods of identifying ... preparation. By using the large-scale screen method ... do is to transfer partial colonies of ... plates into the solutions provided by the ...
GLP-1 (HYB 147-12)...
... KLH-conjugated, synthetic peptide corresponding to ... mouse p19ARF. The epitope ... 62-75. Clone 5-C3-1. Quality ... immunoblot. Stability ...
Biology Products:
(Date:8/26/2014)... environmental and social problems such as global warming ... or does the burden fall on our failure ... to a new study in the Journal ... burden for solving global problems from governments to ... , "When businesses convince politicians to encourage responsible ...
(Date:8/26/2014)... People for the Ethical Treatment of Animals (PETA) and ... be in Prague this week at the 9th World ... Sciences presenting original research on alternatives to the use ... well as studies identifying problems with current laboratory oversight ... from August 24 to 28, 2014, PETA and PISC ...
(Date:8/25/2014)... years ago this month, one of the first U.S. ... State University campus, striking some 2,000 people. A university ... data gathered at the time to gain insight into ... virus,s rapid spread across the university community., The fall ... came in to the university,s Health and Wellness Services ...
Breaking Biology News(10 mins):An inconvenient truth: Does responsible consumption benefit corporations more than society? 2WSU flu outbreak provides rare study material 2WSU flu outbreak provides rare study material 3
... release is available in Spanish . First ... stink bug (BMSB) is now in at least 39 states, is ... threat to orchard fruits, garden vegetables and row crops. It,s no ... its top "invasive insect of interest." But help may ...
... 2013) Autism Speaks, the world,s leading autism science ... million in funding for 14 new research projects. To ... for research projects that advance understanding of the causes, ... "Autism Speaks continues in its steadfast ...
... Even as policy makers and health experts point to an ... and universities in the United States have dropped physical education ... student was required to take physical education and exercise requirements ... low of 39 percent, according to a new study. ...
Cached Biology News:Combating USDA's top-ranked invasive insect 2Autism Speaks awards $4.8 million for new research 2Autism Speaks awards $4.8 million for new research 3Autism Speaks awards $4.8 million for new research 4Autism Speaks awards $4.8 million for new research 5Physical education requirement at 4-year universities at all-time low 2Physical education requirement at 4-year universities at all-time low 3
(Date:8/26/2014)... what they believe is the thinnest-possible semiconductor, a ... only three atoms thick. , The University of ... single-layer semiconductor materials can be connected in an ... result could be the basis for next-generation flexible ... and solar technologies. , "Heterojunctions are fundamental elements ...
(Date:8/26/2014)... , Aug. 26, 2014 An analysis by ... of all Mers CoV virus strains has ... back to 2012.  This conservation and sharing of specific ... Synthetic Mers CoV Blocker-Vaccine™ candidate, as it did for the ... both of which have been found to be effective ...
(Date:8/26/2014)... added to the growing case for graphene being ... thing in the high-tech world by the two-dimensional ... of researchers led by a scientist with the ... Laboratory (Berkeley Lab) has reported the first experimental ... materials. The recorded charge transfer time clocked in ...
(Date:8/26/2014)... Ga. , Aug. 26, 2014  ViveBio, ... biological sample collection, stabilization and transportation, announced today ... Laboratory Procurement Services, LLC (LPS) of ... of products in the United States ... new class of ambient temperature dried biological specimen ...
Breaking Biology Technology:Scientists craft atomically seamless, thinnest-possible semiconductor junctions 2Competition for graphene 2ViveBio and Laboratory Procurement Services Sign Agreement for Distribution of the ViveST Line of Products 2