Navigation Links
Mouse Anti-MAK Monoclonal Antibody, Unconjugated, Clone 4E9 from Abnova Corporation

ProductsMouse Anti-MAK Monoclonal Antibody, Unconjugated, Clone 4E9 from Abnova Corporation
Company Abnova Corporation
Item Mouse Anti-MAK Monoclonal Antibody, Unconjugated, Clone 4E9
Price 
Description Mouse monoclonal antibody raised against a partial recombinant MAK.
Immunogen: MAK (AAH39825, 358 a.a. ~ 457 a.a) partial recombinant protein with GST tag.
Protein Sequence: PPKQQSQEKPPQTLFPSIVKNMPTKPNGTLSHKSGRRRWGQTIFKSGDSWEELEDYDFGASHSKKPSMGVFKEKRKKDSPFRQQVKMAVISLSAHQFPTL
Accession: BC039825
Protein Accession Number: AAH39825
OMIM: 154235,
GeneID: 4117
Lot Number: MM951100652
MA Code: ABVAP914S
Operation Date: 2006/12/22
Info Abnova CorporationAbnova Corporation
Abnova Corporation (HQ)
9th Fl., No. 108, Jhouzih St.
Neihu District, Taipei
114 Taiwan R.O.C.
Tel: +886-2-8751-1888
Fax: +886-2-8751-1166

Abnova GmbH
Boxbergring 107
69126 Heidelberg
Germany
Tel: +49 6221 3632226
Fax: +49 6221 825878

Customer Service: +886-2-8751-1888
Fax Number: +886-2-8751-1166
Web Site: http://www.abnova.com.tw
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Mouse Anti-Amodiaquine Monoclonal Antibody, Unconjugated, Clone 6D10 from AntibodyShop A/S
2. Mouse Anti-Protein S Monoclonal Antibody, Unconjugated, Clone HYB 232-02 from Abcam
3. Mouse Anti-Mouse Glutathione S-transferase M1 (GSTM1) Monoclonal Antibody, Unconjugated from Lifespan Biosciences
4. Mouse Anti-Human S-100 alpha/beta chain Monoclonal Antibody, Unconjugated, Clone 8B10 from Santa Cruz Biotechnology, Inc.
5. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Testis from OriGene Technologies
6. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Brain (adult) from OriGene Technologies
7. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (12.5 - day) from OriGene Technologies
8. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (19 - day) from OriGene Technologies
9. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Thymus from OriGene Technologies
10. Mouse Anti-Human Complement factor B Monoclonal Antibody, Unconjugated, Clone 9B6 from AntibodyShop A/S
11. Mouse Anti-Human Choriongonadotropin (hCG) Monoclonal Antibody, Unconjugated, Clone 5F10 from AntibodyShop A/S
... Slotted migration Chamber lid allows easy gel ... One-touch connectors for easy set up between power ... prevents current flow if the lid is removed ... and durability., Remote control can be ...
... ProFound Label Transfer Sulfo SBED Protein:Protein ... known as Label Transfer has rapidly gained ... protein interaction discovery. A growing number of ... Biotin Label Transfer Reagent to study a ...
... compact benchtop and stackable multi-function incubator. ... a large display screen to accurately ... circulation inside to evenly distribute temperature ... easily calibrated from the microprocessor controller. ...
... label transfer is fast emerging as a ... and confirmation. Until now, only amino groups ... label transfer reagents such as our Sulfo-SBED. ... Mts-Atf-LC-Biotin, are exciting additions to the protein ...
Biology Products:
(Date:12/15/2009)... found the fossil remains of a whale, 4.5 million years ... first time, the results of the decay and fossilisation process ... a baleen whale from the Mysticeti group. , This is ... a whale from the Lower Pliocene (five million years ago) ... first time that the results of the processes of fossilisation ...
(Date:12/15/2009)... Va., Dec. 15 The PTR Group, a ... announced that it has agreed to sponsor three high ... FIRST Robotics Competition ( http://usfirst.org ). ,, ... school teams in three different states. The teams ... Rockwall, TX, and James Madison HS in Vienna, VA ...
(Date:12/14/2009)... diseases can be transmitted by sneezing, touching, or ... face, a habit that may have driven the dinosaurs ... , Jacqueline Upcroft, a member of f1000 Biology, highlights ... published in PLoS One. This led them to deduce ... diseased jaw bones seen in many tyrannosaurid fossils. , ...
Breaking Biology News(10 mins):Story of 4.5 million-year-old whale unveiled in Huelva 2Story of 4.5 million-year-old whale unveiled in Huelva 3The PTR Group Announces Financial and Technical Support to US FIRST Robotics Competition Teams 2Limeade Wellness Program Chosen to Serve Washington State Employees 61055 1Limeade Wellness Program Chosen to Serve Washington State Employees 61055 2Teen Obesity Ups MS Risk in Women 61052 1Teen Obesity Ups MS Risk in Women 61052 2Teen Obesity Ups MS Risk in Women 61052 3Upstate University Health System Launches Knowing Changes Everything Campaign in Partnership with Lewis Communications 61049 1Upstate University Health System Launches Knowing Changes Everything Campaign in Partnership with Lewis Communications 61049 2Upstate University Health System Launches Knowing Changes Everything Campaign in Partnership with Lewis Communications 61049 3
... Cold Spring Harbor Laboratory (CSHL) announced today the discovery ... same time, they reported that their discovery suggests the ... processing in which these and possibly other small RNAs ... multinational project called ENCODE, also provided information concerning the ...
... from the U.S. National Science Foundation and the U.S. ... marked the occasion of the research vessel JOIDES Resolution ... transit to Honolulu, after a complete transformation to modernize ... , The JOIDES Resolution is the U.S. research vessel ...
... 2009 as the bicentennial of Charles Darwin,s birth, experts ... at the University of Utah Feb. 25-27 to debate ... war to domestic abuse and homicide. , "What evolutionary ... this knowledge to promote a more peaceful society?" asks ...
Other Biology News:CSHL scientists find a new class of small RNAs and define its function 2CSHL scientists find a new class of small RNAs and define its function 3Ocean research officials hail completion of modernization for US scientific ocean drilling vessel 2The Evolution of Human Aggression: Feb. 25-27 conference 2The Evolution of Human Aggression: Feb. 25-27 conference 3The Evolution of Human Aggression: Feb. 25-27 conference 4
(Date:12/15/2009)... , - 45 Patients ... of,Cardiopoietic Cells to Restore Cardiac Function ,, ... biotechnology company specialising,in cell-based therapies for the treatment ... two months ahead of schedule,enrolment in the first ... C-Cure, a,unique stem cell therapy for heart failure. ...
(Date:12/14/2009)... FREMONT, Calif., Dec. 14 Vermillion, ... company, today announced William C. Wallen, Ph.D. ... and Development for IDEXX Laboratories, will be ... of Vermillion,s bankruptcy plan. ,, "Bill ... development experience in diagnostics and biotechnology," said ...
(Date:12/14/2009)... -- The third edition of Infusion ... published by the Infusion Nurses Society (INS), includes ... Anthracyclines are a group of chemotherapy medications ... been used in the treatment of various types ... ,, According to the INS publication: "In September ...
(Date:12/14/2009)... Calif., Dec. 14 Nektar Therapeutics (Nasdaq: ... has been appointed to serve on its board ... industry leader with over 35 years of experience ... "Dennis brings to Nektar extensive industry perspective at ... Howard W. Robin, President and CEO of Nektar ...
Breaking Biology Technology:Cardio3 BioSciences Completes Patient Enrolment in First Stage of Pivotal Trial of C-Cure(R) in Heart Failure 2Cardio3 BioSciences Completes Patient Enrolment in First Stage of Pivotal Trial of C-Cure(R) in Heart Failure 3Vermillion Announces Appointment of William C. Wallen, Ph.D. to Board of Directors 2Vermillion Announces Appointment of William C. Wallen, Ph.D. to Board of Directors 3Vermillion Announces Appointment of William C. Wallen, Ph.D. to Board of Directors 4Infusion Nurses Society References Totect(R) (Dexrazoxane For Injection) as the Only Antidote for the Treatment of Anthracycline Extravasation 2Infusion Nurses Society References Totect(R) (Dexrazoxane For Injection) as the Only Antidote for the Treatment of Anthracycline Extravasation 3Infusion Nurses Society References Totect(R) (Dexrazoxane For Injection) as the Only Antidote for the Treatment of Anthracycline Extravasation 4Infusion Nurses Society References Totect(R) (Dexrazoxane For Injection) as the Only Antidote for the Treatment of Anthracycline Extravasation 5Dennis Winger Joins Nektar Therapeutics' Board of Directors 2Dennis Winger Joins Nektar Therapeutics' Board of Directors 3