Navigation Links
Mouse Anti-MAK Monoclonal Antibody, Unconjugated, Clone 4E9 from Abnova Corporation

ProductsMouse Anti-MAK Monoclonal Antibody, Unconjugated, Clone 4E9 from Abnova Corporation
Company Abnova Corporation
Item Mouse Anti-MAK Monoclonal Antibody, Unconjugated, Clone 4E9
Price 
Description Mouse monoclonal antibody raised against a partial recombinant MAK.
Immunogen: MAK (AAH39825, 358 a.a. ~ 457 a.a) partial recombinant protein with GST tag.
Protein Sequence: PPKQQSQEKPPQTLFPSIVKNMPTKPNGTLSHKSGRRRWGQTIFKSGDSWEELEDYDFGASHSKKPSMGVFKEKRKKDSPFRQQVKMAVISLSAHQFPTL
Accession: BC039825
Protein Accession Number: AAH39825
OMIM: 154235,
GeneID: 4117
Lot Number: MM951100652
MA Code: ABVAP914S
Operation Date: 2006/12/22
Info Abnova CorporationAbnova Corporation
Abnova Corporation (HQ)
9th Fl., No. 108, Jhouzih St.
Neihu District, Taipei
114 Taiwan R.O.C.
Tel: +886-2-8751-1888
Fax: +886-2-8751-1166

Abnova GmbH
Boxbergring 107
69126 Heidelberg
Germany
Tel: +49 6221 3632226
Fax: +49 6221 825878

Customer Service: +886-2-8751-1888
Fax Number: +886-2-8751-1166
Web Site: http://www.abnova.com.tw
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Mouse Anti-Amodiaquine Monoclonal Antibody, Unconjugated, Clone 6D10 from AntibodyShop A/S
2. Mouse Anti-Protein S Monoclonal Antibody, Unconjugated, Clone HYB 232-02 from Abcam
3. Mouse Anti-Mouse Glutathione S-transferase M1 (GSTM1) Monoclonal Antibody, Unconjugated from Lifespan Biosciences
4. Mouse Anti-Human S-100 alpha/beta chain Monoclonal Antibody, Unconjugated, Clone 8B10 from Santa Cruz Biotechnology, Inc.
5. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Testis from OriGene Technologies
6. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Brain (adult) from OriGene Technologies
7. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (12.5 - day) from OriGene Technologies
8. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (19 - day) from OriGene Technologies
9. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Thymus from OriGene Technologies
10. Mouse Anti-Human Complement factor B Monoclonal Antibody, Unconjugated, Clone 9B6 from AntibodyShop A/S
11. Mouse Anti-Human Choriongonadotropin (hCG) Monoclonal Antibody, Unconjugated, Clone 5F10 from AntibodyShop A/S
... This CLS number is ... to easily match Cornings product ... yet, please order under the ... contact customer service for assistance. ...
... is a new product number, ... product number. If showing no ... the old Sigma-Aldrich number (C6921) ... assistance. Mfr Desig: Corning ...
...
... T7•Tag ® Ek Adaptor encodes a ... binding site (rbs), ATG translation initation codon, ... T7•Tag is a small epitope tag (11 ... the target protein with T7•Tag Monoclonal Antibody ...
Biology Products:
(Date:4/28/2016)... Sweden , April 28, 2016 First ... M (139.9), up 966% compared with the first quarter of 2015 ... profit totaled SEK 589.1 M (loss: 18.8) and the operating margin ... 7.12 (loss: 0.32) Cash flow from operations was SEK ... The 2016 revenue guidance is unchanged, SEK 7,000-8,500 M. ...
(Date:4/15/2016)...  A new partnership announced today will help ... in a fraction of the time it takes ... life insurance policies to consumers without requiring inconvenient ... Diagnostics, rapid testing (A1C, Cotinine and HIV) and ... weight, pulse, BMI, and activity data) available at ...
(Date:3/31/2016)... RATON, Florida , March 31, 2016 ... LEGX ) ("LegacyXChange" or the "Company") ... for potential users of its soon to be launched ... video ( https://www.youtube.com/channel/UCyTLBzmZogV1y2D6bDkBX5g ) will also provide ... the use of DNA technology to an industry that ...
Breaking Biology News(10 mins):
(Date:5/4/2016)... ... May 04, 2016 , ... Proove Biosciences, Inc. , ... strategic partnership with McGill University . The partnership is designed to advance research ... order to help patients in pain. With the new agreement, researchers at Proove Biosciences ...
(Date:5/4/2016)... ... May 04, 2016 , ... Nutrafol®, a first-to-market smart-supplement for ... and stress related hair loss. With patent-pending formulas for both female hair loss ... in the medical and salon channels nationwide. , Dermatologists, Plastic Surgeons and ...
(Date:5/3/2016)... ... May 03, 2016 , ... Flagship Biosciences, the leader ... to its Board of Directors. Dr. Gillett recently retired from Charles River Laboratories ... and Chief Scientific Officer. A board-certified veterinary pathologist, Dr. Gillett joined Charles River ...
(Date:5/3/2016)... NY (PRWEB) , ... May 03, 2016 , ... According ... Hospital , for definitive prostate cancer treatment, patients traditionally had two main treatment options: ... treatment plan would be made. , New technology has enabled doctors to administer ...
Breaking Biology Technology: