Navigation Links
Mouse Anti-MAK Monoclonal Antibody, Unconjugated, Clone 4E9 from Abnova Corporation

ProductsMouse Anti-MAK Monoclonal Antibody, Unconjugated, Clone 4E9 from Abnova Corporation
Company Abnova Corporation
Item Mouse Anti-MAK Monoclonal Antibody, Unconjugated, Clone 4E9
Price 
Description Mouse monoclonal antibody raised against a partial recombinant MAK.
Immunogen: MAK (AAH39825, 358 a.a. ~ 457 a.a) partial recombinant protein with GST tag.
Protein Sequence: PPKQQSQEKPPQTLFPSIVKNMPTKPNGTLSHKSGRRRWGQTIFKSGDSWEELEDYDFGASHSKKPSMGVFKEKRKKDSPFRQQVKMAVISLSAHQFPTL
Accession: BC039825
Protein Accession Number: AAH39825
OMIM: 154235,
GeneID: 4117
Lot Number: MM951100652
MA Code: ABVAP914S
Operation Date: 2006/12/22
Info Abnova CorporationAbnova Corporation
Abnova Corporation (HQ)
9th Fl., No. 108, Jhouzih St.
Neihu District, Taipei
114 Taiwan R.O.C.
Tel: +886-2-8751-1888
Fax: +886-2-8751-1166

Abnova GmbH
Boxbergring 107
69126 Heidelberg
Germany
Tel: +49 6221 3632226
Fax: +49 6221 825878

Customer Service: +886-2-8751-1888
Fax Number: +886-2-8751-1166
Web Site: http://www.abnova.com.tw
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Mouse Anti-Amodiaquine Monoclonal Antibody, Unconjugated, Clone 6D10 from AntibodyShop A/S
2. Mouse Anti-Protein S Monoclonal Antibody, Unconjugated, Clone HYB 232-02 from Abcam
3. Mouse Anti-Mouse Glutathione S-transferase M1 (GSTM1) Monoclonal Antibody, Unconjugated from Lifespan Biosciences
4. Mouse Anti-Human S-100 alpha/beta chain Monoclonal Antibody, Unconjugated, Clone 8B10 from Santa Cruz Biotechnology, Inc.
5. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Testis from OriGene Technologies
6. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Brain (adult) from OriGene Technologies
7. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (12.5 - day) from OriGene Technologies
8. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (19 - day) from OriGene Technologies
9. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Thymus from OriGene Technologies
10. Mouse Anti-Human Complement factor B Monoclonal Antibody, Unconjugated, Clone 9B6 from AntibodyShop A/S
11. Mouse Anti-Human Choriongonadotropin (hCG) Monoclonal Antibody, Unconjugated, Clone 5F10 from AntibodyShop A/S
... BioGenex VISION Sytem is a highly ... with proprietary digital imaging and automation ... image acquisition, analysis, archving/retrieval and colored ... state-of-the-art digital imaging system that aids ...
... Zero -mr agarose is ... no detectable endoosmosis, and is ... high molecular weight proteins or ... varying degrees of molecular sieving ...
... is used for second-dimension SDS-PAGE sample ... place in PROTEAN Plus cells. Bromophenol ... allow monitoring of electrophoresis runs. The ... in 1x Tris, glycine, SDS, and ...
The Trans-Blot Plus gel and cassette assembly tray is used to hold the Trans-Blot Plus gel holder cassette, buffer, and other materials for the gel and membrane sandwich during their assembly....
Biology Products:
(Date:3/23/2017)... Research and Markets has announced the addition of the "Global ... 2025" report to their offering. ... The Global Vehicle Anti-Theft System Market is ... next decade to reach approximately $14.21 billion by 2025. ... all the given segments on global as well as regional levels ...
(Date:3/20/2017)... Pa. , March 20, 2017 PMD ... 2.0 personal spirometer and Wellness Management System (WMS), a ... Founded in 2010, PMD Healthcare is a Medical ... with a mission dedicated to creating innovative solutions that ... life. With that intent focus, PMD developed the first ...
(Date:3/7/2017)... -- Brandwatch , the leading social intelligence company, today announces ... to uncover insights to support its reporting, help direct future campaigns, ... leading youth charity will be using Brandwatch Analytics social listening and ... understanding of the topics and issues that are a priority for ... "Until ...
Breaking Biology News(10 mins):
(Date:3/27/2017)... ... March 27, 2017 , ... IsoPlexis Corporation (IsoPlexis), a venture ... and more through a single-cell precision engineering platform, today announced it has received ... in the laboratory of Dr. James Heath at the California Institute of Technology, ...
(Date:3/27/2017)... , March 27, 2017  The global ... for 2016, according to a new report from ... lab testing is performed to evaluate disease progression, ... therapy, among other reasons.  The healthcare market research ... , provides an overview of the medical ...
(Date:3/27/2017)... ... March 27, 2017 , ... ... engineer scalable and customizable vascular grafts in JoVE’s Video Journal, the world’s first ... new and improved ways of treating coronary artery disease (CAD). Lam is an ...
(Date:3/24/2017)... 24, 2017 MiMedx Group, Inc. (NASDAQ: MDXG), ... placental tissue allografts and patent-protected processes to develop and ... healthcare, announced today  that it will present at the ... , NY.  Parker H. "Pete" Petit, Chairman and CEO, ... Christopher M. Cashman , EVP and Chief Commercialization Officer, ...
Breaking Biology Technology: