Mouse Anti-MAK Monoclonal Antibody, Unconjugated, Clone 4E9 from Abnova Corporation

Products	Mouse Anti-MAK Monoclonal Antibody, Unconjugated, Clone 4E9 from Abnova Corporation
Company	Abnova Corporation
Item	Mouse Anti-MAK Monoclonal Antibody, Unconjugated, Clone 4E9
Price
Description	Mouse monoclonal antibody raised against a partial recombinant MAK. Immunogen: MAK (AAH39825, 358 a.a. ~ 457 a.a) partial recombinant protein with GST tag. Protein Sequence: PPKQQSQEKPPQTLFPSIVKNMPTKPNGTLSHKSGRRRWGQTIFKSGDSWEELEDYDFGASHSKKPSMGVFKEKRKKDSPFRQQVKMAVISLSAHQFPTL Accession: BC039825 Protein Accession Number: AAH39825 OMIM: 154235, GeneID: 4117 Lot Number: MM951100652 MA Code: ABVAP914S Operation Date: 2006/12/22
Info	Abnova Corporation Abnova Corporation (HQ) 9th Fl., No. 108, Jhouzih St. Neihu District, Taipei 114 Taiwan R.O.C. Tel: +886-2-8751-1888 Fax: +886-2-8751-1166 Abnova GmbH Boxbergring 107 69126 Heidelberg Germany Tel: +49 6221 3632226 Fax: +49 6221 825878 Customer Service: +886-2-8751-1888 Fax Number: +886-2-8751-1166 Web Site: http://www.abnova.com.tw

NOTE: Price information is approximate list price and actual prices may vary.

TAG: Mouse Anti MAK Monoclonal Antibody Unconjugated Clone from Abnova Corporation

... Slotted migration Chamber lid allows easy gel ... One-touch connectors for easy set up between power ... prevents current flow if the lid is removed ... and durability., Remote control can be ...

... ProFound Label Transfer Sulfo SBED Protein:Protein ... known as Label Transfer has rapidly gained ... protein interaction discovery. A growing number of ... Biotin Label Transfer Reagent to study a ...

... compact benchtop and stackable multi-function incubator. ... a large display screen to accurately ... circulation inside to evenly distribute temperature ... easily calibrated from the microprocessor controller. ...

... label transfer is fast emerging as a ... and confirmation. Until now, only amino groups ... label transfer reagents such as our Sulfo-SBED. ... Mts-Atf-LC-Biotin, are exciting additions to the protein ...

Biology Products:

Mini Horizontal Electrophoresis Unit i-MyRun.NC from Cosmo Bio Co., Ltd.ProFound Label Transfer Sulfo SBED Protein:Protein Interaction Reagent from Pierce Biotechnology, Inc.Incubator with Vortexing Shaker and Rotisserie from Major Science Mts-Atf-Biotin Label Transfer Reagent, 5 mg from Pierce Biotechnology, Inc.

(Date:12/15/2009)... found the fossil remains of a whale, 4.5 million years ... first time, the results of the decay and fossilisation process ... a baleen whale from the Mysticeti group. , This is ... a whale from the Lower Pliocene (five million years ago) ... first time that the results of the processes of fossilisation ...

(Date:12/15/2009)... Va., Dec. 15 The PTR Group, a ... announced that it has agreed to sponsor three high ... FIRST Robotics Competition ( http://usfirst.org ). ,, ... school teams in three different states. The teams ... Rockwall, TX, and James Madison HS in Vienna, VA ...

(Date:12/14/2009)... diseases can be transmitted by sneezing, touching, or ... face, a habit that may have driven the dinosaurs ... , Jacqueline Upcroft, a member of f1000 Biology, highlights ... published in PLoS One. This led them to deduce ... diseased jaw bones seen in many tyrannosaurid fossils. , ...

Breaking Biology News(10 mins):Story of 4.5 million-year-old whale unveiled in Huelva 2 Story of 4.5 million-year-old whale unveiled in Huelva 3 The PTR Group Announces Financial and Technical Support to US FIRST Robotics Competition Teams 2 Limeade Wellness Program Chosen to Serve Washington State Employees 61055 1 Limeade Wellness Program Chosen to Serve Washington State Employees 61055 2 Teen Obesity Ups MS Risk in Women 61052 1 Teen Obesity Ups MS Risk in Women 61052 2 Teen Obesity Ups MS Risk in Women 61052 3 Upstate University Health System Launches Knowing Changes Everything Campaign in Partnership with Lewis Communications 61049 1 Upstate University Health System Launches Knowing Changes Everything Campaign in Partnership with Lewis Communications 61049 2 Upstate University Health System Launches Knowing Changes Everything Campaign in Partnership with Lewis Communications 61049 3

[0] Story of 4.5 million-year-old whale unveiled in Huelva [0] The PTR Group Announces Financial and Technical Support to US FIRST Robotics Competition Teams [0] Good dentistry may have saved the dinosaurs

... Cold Spring Harbor Laboratory (CSHL) announced today the discovery ... same time, they reported that their discovery suggests the ... processing in which these and possibly other small RNAs ... multinational project called ENCODE, also provided information concerning the ...

... from the U.S. National Science Foundation and the U.S. ... marked the occasion of the research vessel JOIDES Resolution ... transit to Honolulu, after a complete transformation to modernize ... , The JOIDES Resolution is the U.S. research vessel ...

... 2009 as the bicentennial of Charles Darwin,s birth, experts ... at the University of Utah Feb. 25-27 to debate ... war to domestic abuse and homicide. , "What evolutionary ... this knowledge to promote a more peaceful society?" asks ...

Other Biology News:CSHL scientists find a new class of small RNAs and define its function 2 CSHL scientists find a new class of small RNAs and define its function 3 Ocean research officials hail completion of modernization for US scientific ocean drilling vessel 2 The Evolution of Human Aggression: Feb. 25-27 conference 2 The Evolution of Human Aggression: Feb. 25-27 conference 3 The Evolution of Human Aggression: Feb. 25-27 conference 4

CSHL scientists find a new class of small RNAs and define its function Ocean research officials hail completion of modernization for US scientific ocean drilling vessel The Evolution of Human Aggression: Feb. 25-27 conference

(Date:12/15/2009)... , - 45 Patients ... of,Cardiopoietic Cells to Restore Cardiac Function ,, ... biotechnology company specialising,in cell-based therapies for the treatment ... two months ahead of schedule,enrolment in the first ... C-Cure, a,unique stem cell therapy for heart failure. ...

(Date:12/14/2009)... FREMONT, Calif., Dec. 14 Vermillion, ... company, today announced William C. Wallen, Ph.D. ... and Development for IDEXX Laboratories, will be ... of Vermillion,s bankruptcy plan. ,, "Bill ... development experience in diagnostics and biotechnology," said ...

(Date:12/14/2009)... -- The third edition of Infusion ... published by the Infusion Nurses Society (INS), includes ... Anthracyclines are a group of chemotherapy medications ... been used in the treatment of various types ... ,, According to the INS publication: "In September ...

(Date:12/14/2009)... Calif., Dec. 14 Nektar Therapeutics (Nasdaq: ... has been appointed to serve on its board ... industry leader with over 35 years of experience ... "Dennis brings to Nektar extensive industry perspective at ... Howard W. Robin, President and CEO of Nektar ...

Breaking Biology Technology:Cardio3 BioSciences Completes Patient Enrolment in First Stage of Pivotal Trial of C-Cure(R) in Heart Failure 2 Cardio3 BioSciences Completes Patient Enrolment in First Stage of Pivotal Trial of C-Cure(R) in Heart Failure 3 Vermillion Announces Appointment of William C. Wallen, Ph.D. to Board of Directors 2 Vermillion Announces Appointment of William C. Wallen, Ph.D. to Board of Directors 3 Vermillion Announces Appointment of William C. Wallen, Ph.D. to Board of Directors 4 Infusion Nurses Society References Totect(R) (Dexrazoxane For Injection) as the Only Antidote for the Treatment of Anthracycline Extravasation 2 Infusion Nurses Society References Totect(R) (Dexrazoxane For Injection) as the Only Antidote for the Treatment of Anthracycline Extravasation 3 Infusion Nurses Society References Totect(R) (Dexrazoxane For Injection) as the Only Antidote for the Treatment of Anthracycline Extravasation 4 Infusion Nurses Society References Totect(R) (Dexrazoxane For Injection) as the Only Antidote for the Treatment of Anthracycline Extravasation 5 Dennis Winger Joins Nektar Therapeutics' Board of Directors 2 Dennis Winger Joins Nektar Therapeutics' Board of Directors 3

[0] Cardio3 BioSciences Completes Patient Enrolment in First Stage of Pivotal Trial of C-Cure(R) in Heart Failure [0] Vermillion Announces Appointment of William C. Wallen, Ph.D. to Board of Directors [0] Infusion Nurses Society References Totect(R) (Dexrazoxane For Injection) as the Only Antidote for the Treatment of Anthracycline Extravasation [0] Dennis Winger Joins Nektar Therapeutics' Board of Directors