Navigation Links
Mouse Anti-MAK Monoclonal Antibody, Unconjugated, Clone 4E9 from Abnova Corporation

ProductsMouse Anti-MAK Monoclonal Antibody, Unconjugated, Clone 4E9 from Abnova Corporation
Company Abnova Corporation
Item Mouse Anti-MAK Monoclonal Antibody, Unconjugated, Clone 4E9
Price 
Description Mouse monoclonal antibody raised against a partial recombinant MAK.
Immunogen: MAK (AAH39825, 358 a.a. ~ 457 a.a) partial recombinant protein with GST tag.
Protein Sequence: PPKQQSQEKPPQTLFPSIVKNMPTKPNGTLSHKSGRRRWGQTIFKSGDSWEELEDYDFGASHSKKPSMGVFKEKRKKDSPFRQQVKMAVISLSAHQFPTL
Accession: BC039825
Protein Accession Number: AAH39825
OMIM: 154235,
GeneID: 4117
Lot Number: MM951100652
MA Code: ABVAP914S
Operation Date: 2006/12/22
Info Abnova CorporationAbnova Corporation
Abnova Corporation (HQ)
9th Fl., No. 108, Jhouzih St.
Neihu District, Taipei
114 Taiwan R.O.C.
Tel: +886-2-8751-1888
Fax: +886-2-8751-1166

Abnova GmbH
Boxbergring 107
69126 Heidelberg
Germany
Tel: +49 6221 3632226
Fax: +49 6221 825878

Customer Service: +886-2-8751-1888
Fax Number: +886-2-8751-1166
Web Site: http://www.abnova.com.tw
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Mouse Anti-Amodiaquine Monoclonal Antibody, Unconjugated, Clone 6D10 from AntibodyShop A/S
2. Mouse Anti-Protein S Monoclonal Antibody, Unconjugated, Clone HYB 232-02 from Abcam
3. Mouse Anti-Mouse Glutathione S-transferase M1 (GSTM1) Monoclonal Antibody, Unconjugated from Lifespan Biosciences
4. Mouse Anti-Human S-100 alpha/beta chain Monoclonal Antibody, Unconjugated, Clone 8B10 from Santa Cruz Biotechnology, Inc.
5. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Testis from OriGene Technologies
6. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Brain (adult) from OriGene Technologies
7. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (12.5 - day) from OriGene Technologies
8. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (19 - day) from OriGene Technologies
9. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Thymus from OriGene Technologies
10. Mouse Anti-Human Complement factor B Monoclonal Antibody, Unconjugated, Clone 9B6 from AntibodyShop A/S
11. Mouse Anti-Human Choriongonadotropin (hCG) Monoclonal Antibody, Unconjugated, Clone 5F10 from AntibodyShop A/S
All-in-one mix, removes primers and dNTPs from PCR product for following direct sequencing...
...
...
... APAgene kits are designed to rapidly ... using our patented APA Technology. APAgene provides ... competitive price. All necessary ingredients are provided ... kit can be used for insert-end amplification ...
Biology Products:
(Date:8/18/2015)... , Aug. 18, 2015  Navitas today ... contributor to the Submission Content Management webinar ... a non-profit forum. Dedicated to the Implementation of ... neutral platform for industry, vendors, health authorities, ... and work towards a standard method of ...
(Date:8/12/2015)... , August 12, 2015 As ... mobile payment innovation and advanced biometrics technology is accelerating ... way consumers rely on using their credit cards, the ... the future for payment services led by companies in ... ), :  Google, Inc. (NASDAQ: GOOG ), Apple ...
(Date:8/10/2015)... , August 10, 2015 ... Eye Tracking Technology for more than two decades, announces ... for integration into all consumer display formats. The SMI ... integration of eye tracking into consumer tablets, laptops, desktop ... smart glasses. Omnivision,s leading sensor technology contributes to the ...
Breaking Biology News(10 mins):Navitas, a Key Contributor in IRISS Forum Webinar 2Navitas, a Key Contributor in IRISS Forum Webinar 3Digital Wallet Devices & Mobile Payment Management Services Gain a Distinct Advantage in the Digital Payment Evolution as Demand Continues to Grow 2Digital Wallet Devices & Mobile Payment Management Services Gain a Distinct Advantage in the Digital Payment Evolution as Demand Continues to Grow 3Digital Wallet Devices & Mobile Payment Management Services Gain a Distinct Advantage in the Digital Payment Evolution as Demand Continues to Grow 4Digital Wallet Devices & Mobile Payment Management Services Gain a Distinct Advantage in the Digital Payment Evolution as Demand Continues to Grow 5Digital Wallet Devices & Mobile Payment Management Services Gain a Distinct Advantage in the Digital Payment Evolution as Demand Continues to Grow 6SMI Completes OEM Eye Tracking Platform to Cover All Consumer Displays 2SMI Completes OEM Eye Tracking Platform to Cover All Consumer Displays 3
... The stem cells that produce bird feathers have been visualized ... in a scientific journey that may ultimately shed light on ... 15 issue of the journal Nature, was performed by a ... Medicine of the University of Southern California. , "What we ...
... drought, otherwise harmless snails likely killed off thousands of ... years. , Periwinkle snails, known to science as Littoraria ... drought, which lasted from 1999 to 2001, weakened and ... so extensively that the snails moved from finishing off ...
... Johns Hopkins' senior hospital epidemiologist and flu expert is ... as the best means of protecting patients and hospital ... Studies by other United States researchers show that voluntary ... year, nearly 40,000 Americans die from influenza, many of ...
Cached Biology News:USC researchers track down the stem cells that create feathers 2USC researchers track down the stem cells that create feathers 3Research: Snails were overlooked contributors to marsh destruction 2Research: Snails were overlooked contributors to marsh destruction 3Johns Hopkins flu expert calls for mandatory vaccination of health care workers 2Johns Hopkins flu expert calls for mandatory vaccination of health care workers 3
(Date:9/2/2015)... ... September 02, 2015 , ... The ... the use of special anti-vascular endothelial growth factor agents given by injection into ... does not have a scientific protocol for the many millions diagnosed with it. ...
(Date:9/2/2015)... , Sep. 02, 2015 ... ) has announced the addition of Jain ... Markets and Companies" to their offering. ... several technologies besides fluorescence in situ hybridization ... FISH. Molecular cytogenetics includes application of nanobiotechnology, ...
(Date:9/2/2015)... Sept. 2, 2015  Neurotech Pharmaceuticals, Inc., announced ... the multicenter Phase 2 clinical trial of NT-503 ... of recurrent subfoveal choroidal neovascularization secondary to age ... unique vascular endothelial growth factor (VEGF) receptor protein ... "This landmark proof-of-concept study will evaluate NT-503 ...
(Date:9/2/2015)... FRANCISCO, Calif. , Sept. 2, 2015 ... Bonnie H. Anderson , president and chief executive ... Conference on Wednesday, September 16, 2015 at 10:30 a.m. ... The live audio webcast and subsequent ... . The webcast will be available shortly after conclusion ...
Breaking Biology Technology:StemCell GeneticMed Announces That It Has Started Stem Cell Treatments for Age Related Dry Macular Degeneration (AMG) 2Global Cytogenetics Technologies Study 2015-2025 - Latest Markets and Companies Analysis 2Global Cytogenetics Technologies Study 2015-2025 - Latest Markets and Companies Analysis 3Neurotech Announces First Patient Enrolled in Novel Anti-VEGF Encapsulated Cell Therapy Study 2Neurotech Announces First Patient Enrolled in Novel Anti-VEGF Encapsulated Cell Therapy Study 3Neurotech Announces First Patient Enrolled in Novel Anti-VEGF Encapsulated Cell Therapy Study 4Veracyte to Present at Morgan Stanley Global Healthcare Conference 2