Navigation Links
Mouse Anti-MAK Monoclonal Antibody, Unconjugated, Clone 4E9 from Abnova Corporation

ProductsMouse Anti-MAK Monoclonal Antibody, Unconjugated, Clone 4E9 from Abnova Corporation
Company Abnova Corporation
Item Mouse Anti-MAK Monoclonal Antibody, Unconjugated, Clone 4E9
Price 
Description Mouse monoclonal antibody raised against a partial recombinant MAK.
Immunogen: MAK (AAH39825, 358 a.a. ~ 457 a.a) partial recombinant protein with GST tag.
Protein Sequence: PPKQQSQEKPPQTLFPSIVKNMPTKPNGTLSHKSGRRRWGQTIFKSGDSWEELEDYDFGASHSKKPSMGVFKEKRKKDSPFRQQVKMAVISLSAHQFPTL
Accession: BC039825
Protein Accession Number: AAH39825
OMIM: 154235,
GeneID: 4117
Lot Number: MM951100652
MA Code: ABVAP914S
Operation Date: 2006/12/22
Info Abnova CorporationAbnova Corporation
Abnova Corporation (HQ)
9th Fl., No. 108, Jhouzih St.
Neihu District, Taipei
114 Taiwan R.O.C.
Tel: +886-2-8751-1888
Fax: +886-2-8751-1166

Abnova GmbH
Boxbergring 107
69126 Heidelberg
Germany
Tel: +49 6221 3632226
Fax: +49 6221 825878

Customer Service: +886-2-8751-1888
Fax Number: +886-2-8751-1166
Web Site: http://www.abnova.com.tw
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Mouse Anti-Amodiaquine Monoclonal Antibody, Unconjugated, Clone 6D10 from AntibodyShop A/S
2. Mouse Anti-Protein S Monoclonal Antibody, Unconjugated, Clone HYB 232-02 from Abcam
3. Mouse Anti-Mouse Glutathione S-transferase M1 (GSTM1) Monoclonal Antibody, Unconjugated from Lifespan Biosciences
4. Mouse Anti-Human S-100 alpha/beta chain Monoclonal Antibody, Unconjugated, Clone 8B10 from Santa Cruz Biotechnology, Inc.
5. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Testis from OriGene Technologies
6. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Brain (adult) from OriGene Technologies
7. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (12.5 - day) from OriGene Technologies
8. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (19 - day) from OriGene Technologies
9. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Thymus from OriGene Technologies
10. Mouse Anti-Human Complement factor B Monoclonal Antibody, Unconjugated, Clone 9B6 from AntibodyShop A/S
11. Mouse Anti-Human Choriongonadotropin (hCG) Monoclonal Antibody, Unconjugated, Clone 5F10 from AntibodyShop A/S
... (PDF-MALDI) source provides fast, easy, and ultrasensitive ... online separation. Paired with an Agilent 6300 ... Spectrum Mill software, the PDF-MALDI source is ... digests. It provides clean, searchable MS/MS spectra ...
... Vibratome Roto-Shake Genie is an all-in-one ... It performs five different mixing motions: ... rotating/rolling, as well as a combination ... precision-engineered moving portion of the Vibraotme ...
McCoy's 5A Medium. Without Tryptose or Phosphate Broth. Contains Sodium Bicarbonate....
... Kit uses a simplified procedure and streamlines ... The kit is based on the three ... and sodium bisulfite where cytosine is converted ... innovative in-column desulphonation reaction eliminates several precipitation ...
Biology Products:
(Date:1/22/2016)... Jan. 22, 2016 ... of the "Global Biometrics Market in ... offering. --> http://www.researchandmarkets.com/research/p74whf/global_biometrics ) ... "Global Biometrics Market in Retail Sector 2016-2020" ... --> Research and Markets ( http://www.researchandmarkets.com/research/p74whf/global_biometrics ...
(Date:1/20/2016)... SAN JOSE, Calif. , Jan. 20, 2016 ... leading developer of human interface solutions, today announced ... touch controller solution for wearables and small screen ... appliances such as printers. Supporting round and rectangular ... the S1423 offers excellent performance with moisture on ...
(Date:1/13/2016)... , January 13, 2016 /PRNewswire/ ... announced the addition of the  "India ... Estimation & Forecast (2015-2020)"  report ... http://www.researchandmarkets.com/research/7h6hnn/india_biometrics ) has announced the addition ... Identification Market - Estimation & Forecast ...
Breaking Biology News(10 mins):
(Date:2/9/2016)... DelveInsight,s, "Protein-Tyrosine Phosphatase ... in depth insights on the pipeline drugs ... Phosphatase 1B (PTP1B) Inhibitors. The DelveInsight,s Report ... of development including Discovery, Pre-clinical, IND, Phase ... Report covers the product clinical trials information ...
(Date:2/8/2016)... February 8, 2016 ... Limited, an innovation-driven oncology company developing next generation ... toxic, today announced that chairman emeritus of Tata ... in the company as part of the first ... existing investors Navam Capital and Aarin Capital. ...
(Date:2/8/2016)... ... 08, 2016 , ... Information Management Services ( IMS ) is pleased to ... completely new technical foundation and is so significant it was endowed with a new ... speed for search results, a streamlined layout and a more intuitive format for navigating ...
(Date:2/8/2016)... an active R&D program for the development of future natural ... a unique research and development center in Israel ... products. Stockton has a variety of ... and is active in more than 35 counties worldwide. ... flagship product Timorex Gold ® is used ...
Breaking Biology Technology: