Navigation Links
Mouse Anti-MAK Monoclonal Antibody, Unconjugated, Clone 4E9 from Abnova Corporation

ProductsMouse Anti-MAK Monoclonal Antibody, Unconjugated, Clone 4E9 from Abnova Corporation
Company Abnova Corporation
Item Mouse Anti-MAK Monoclonal Antibody, Unconjugated, Clone 4E9
Price 
Description Mouse monoclonal antibody raised against a partial recombinant MAK.
Immunogen: MAK (AAH39825, 358 a.a. ~ 457 a.a) partial recombinant protein with GST tag.
Protein Sequence: PPKQQSQEKPPQTLFPSIVKNMPTKPNGTLSHKSGRRRWGQTIFKSGDSWEELEDYDFGASHSKKPSMGVFKEKRKKDSPFRQQVKMAVISLSAHQFPTL
Accession: BC039825
Protein Accession Number: AAH39825
OMIM: 154235,
GeneID: 4117
Lot Number: MM951100652
MA Code: ABVAP914S
Operation Date: 2006/12/22
Info Abnova CorporationAbnova Corporation
Abnova Corporation (HQ)
9th Fl., No. 108, Jhouzih St.
Neihu District, Taipei
114 Taiwan R.O.C.
Tel: +886-2-8751-1888
Fax: +886-2-8751-1166

Abnova GmbH
Boxbergring 107
69126 Heidelberg
Germany
Tel: +49 6221 3632226
Fax: +49 6221 825878

Customer Service: +886-2-8751-1888
Fax Number: +886-2-8751-1166
Web Site: http://www.abnova.com.tw
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Mouse Anti-Amodiaquine Monoclonal Antibody, Unconjugated, Clone 6D10 from AntibodyShop A/S
2. Mouse Anti-Protein S Monoclonal Antibody, Unconjugated, Clone HYB 232-02 from Abcam
3. Mouse Anti-Mouse Glutathione S-transferase M1 (GSTM1) Monoclonal Antibody, Unconjugated from Lifespan Biosciences
4. Mouse Anti-Human S-100 alpha/beta chain Monoclonal Antibody, Unconjugated, Clone 8B10 from Santa Cruz Biotechnology, Inc.
5. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Testis from OriGene Technologies
6. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Brain (adult) from OriGene Technologies
7. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (12.5 - day) from OriGene Technologies
8. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (19 - day) from OriGene Technologies
9. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Thymus from OriGene Technologies
10. Mouse Anti-Human Complement factor B Monoclonal Antibody, Unconjugated, Clone 9B6 from AntibodyShop A/S
11. Mouse Anti-Human Choriongonadotropin (hCG) Monoclonal Antibody, Unconjugated, Clone 5F10 from AntibodyShop A/S
X-gal,1g...
Standard 2" or 3" Plastic can be ordered with 81 or 100 cell dividers. Mini 2" Plastics Boxes come standard with 25 cell dividers. Plastic boxes can also be ordered with corresponding freezer racks...
... Conjugation, Quantities to Kilograms, ... Special amino acids and their ... labeling AMC, aldehyde, CMK, Purity ... Chromogenic/Flurogenic Substrates, Solid Phase/Solution/Segment ...
... The Gla-type Osteocalcin EIA Kit is ... kit for quantitative determination of human ... cell culture supernatants, and other biological ... research use only. It is not ...
Biology Products:
(Date:5/19/2015)... May 19, 2015 ... the addition of the  "Genetic Testing Market ... (Logo: http://photos.prnewswire.com/prnh/20130307/600769) , ,A recent report, Genetic ... analysis of the current and future genetic ... tests, their working principles and types are ...
(Date:5/14/2015)... 14, 2015 Research and Markets ( ... "Fingerprint Sensors Market in Smart Mobile Devices " ... that 2014 was a watershed year for fingerprint sensors ... ,Apple Pay,. Apple gave fingerprint sensors a raison d,etre ... Fingerprint sensors are a must-have feature in flagship smartphones. ...
(Date:5/11/2015)... Calif. , May 11, 2015  Synaptics ... of human interface solutions, today announced the appointment ... President and Chief Financial Officer, reporting to ... replaces Synaptics, current Chief Financial Officer, Kathleen ... 2014. Mr. Ali brings extensive ...
Breaking Biology News(10 mins):Global Genetic Testing Market Outlook 2018 2Global Smart Mobile Devices Fingerprint Sensors Market 2015-2019: Key Vendors are Authentec, Validity Sensors, Fingerprint Cards, Next Biometrics Group. IDEX, and Qualcomm 2Synaptics Appoints Wajid Ali as Senior Vice President and Chief Financial Officer 2
... vaccine that enlists help from the immune system to keep ... to help smokers quit and to limit the urge to ... being developed by Nabi Biopharmaceuticals to prevent and treat nicotine ... smoker inhales, nicotine is carried by the bloodstream to the ...
... Scientists at the Albert Einstein College of Medicine of ... gene expression can occur in the form of discrete ... techniques, developed by Dr. Robert Singer and colleagues at ... directly watch the behavior of a single gene in ...
... subpopulation of helper T-cells provides immunity and promotes survival ... means of predicting an AIDS vaccine's effectiveness, a discovery ... in clinical trials. , Led by researchers at Beth ... Center (VRC) at the National Institute of Allergy and ...
Cached Biology News:Einstein researchers take the pulse of a gene in living cells 2AIDS vaccine research offers new insights on survival 2AIDS vaccine research offers new insights on survival 3
(Date:6/1/2015)... - BIOREM Inc. (TSX-V: BRM) ("Biorem" or "the Company") today announced results ... 2015 first quarter financial statements and MD&A have been filed on ... March 31,(in CDN$,000 except per share data) , 2015 ... Gross profit , 1,531 , 329 Ebitda* , ... 528 , (531) Basic earnings (loss) per share ...
(Date:6/1/2015)... 01, 2015 Regis Technologies, Inc. ... of chiral stationary phases (CSPs) for analytical and ... current and presenting solutions for new clients, Regis ... This valuable addition to its core expertise in ... that can tackle projects for the scale clients ...
(Date:6/1/2015)... -- Neogen Corporation (NASDAQ: NEOG ) announced today that it ... commercial food testing laboratory based in southwest India ... a base for the company,s new operations in ... was incorporated in 1990, and its business has grown ... quality testing for major hotels and restaurants in its home ...
(Date:6/1/2015)... 2015 Esperance Pharmaceuticals Inc. today reported positive ... EP-100 in ovarian cancer patients resistant to paclitaxel. EP-100 ... destroy cancer cells that overexpress luteinizing hormone-releasing hormone (LHRH) ... a wide range of cancers. Results ... EP-100 were presented at the 2015 ASCO Annual ...
Breaking Biology Technology:Biorem Reports Increased Revenues and Earnings for First Quarter 2Biorem Reports Increased Revenues and Earnings for First Quarter 3Regis Technologies Offers Chiral Chromatography Service 2Regis Technologies Offers Chiral Chromatography Service 3Neogen acquires India food safety company 2Esperance Reports Positive EP-100 Phase ll Results in Ovarian Cancer at 2015 ASCO Annual Meeting 2Esperance Reports Positive EP-100 Phase ll Results in Ovarian Cancer at 2015 ASCO Annual Meeting 3