Navigation Links
Mouse Anti-MAK Monoclonal Antibody, Unconjugated, Clone 4E9 from Abnova Corporation

ProductsMouse Anti-MAK Monoclonal Antibody, Unconjugated, Clone 4E9 from Abnova Corporation
Company Abnova Corporation
Item Mouse Anti-MAK Monoclonal Antibody, Unconjugated, Clone 4E9
Price 
Description Mouse monoclonal antibody raised against a partial recombinant MAK.
Immunogen: MAK (AAH39825, 358 a.a. ~ 457 a.a) partial recombinant protein with GST tag.
Protein Sequence: PPKQQSQEKPPQTLFPSIVKNMPTKPNGTLSHKSGRRRWGQTIFKSGDSWEELEDYDFGASHSKKPSMGVFKEKRKKDSPFRQQVKMAVISLSAHQFPTL
Accession: BC039825
Protein Accession Number: AAH39825
OMIM: 154235,
GeneID: 4117
Lot Number: MM951100652
MA Code: ABVAP914S
Operation Date: 2006/12/22
Info Abnova CorporationAbnova Corporation
Abnova Corporation (HQ)
9th Fl., No. 108, Jhouzih St.
Neihu District, Taipei
114 Taiwan R.O.C.
Tel: +886-2-8751-1888
Fax: +886-2-8751-1166

Abnova GmbH
Boxbergring 107
69126 Heidelberg
Germany
Tel: +49 6221 3632226
Fax: +49 6221 825878

Customer Service: +886-2-8751-1888
Fax Number: +886-2-8751-1166
Web Site: http://www.abnova.com.tw
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Mouse Anti-Amodiaquine Monoclonal Antibody, Unconjugated, Clone 6D10 from AntibodyShop A/S
2. Mouse Anti-Protein S Monoclonal Antibody, Unconjugated, Clone HYB 232-02 from Abcam
3. Mouse Anti-Mouse Glutathione S-transferase M1 (GSTM1) Monoclonal Antibody, Unconjugated from Lifespan Biosciences
4. Mouse Anti-Human S-100 alpha/beta chain Monoclonal Antibody, Unconjugated, Clone 8B10 from Santa Cruz Biotechnology, Inc.
5. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Testis from OriGene Technologies
6. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Brain (adult) from OriGene Technologies
7. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (12.5 - day) from OriGene Technologies
8. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (19 - day) from OriGene Technologies
9. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Thymus from OriGene Technologies
10. Mouse Anti-Human Complement factor B Monoclonal Antibody, Unconjugated, Clone 9B6 from AntibodyShop A/S
11. Mouse Anti-Human Choriongonadotropin (hCG) Monoclonal Antibody, Unconjugated, Clone 5F10 from AntibodyShop A/S
...
These 18x18 square No.1 Corning cover glasses are made from No. 0211 zinc titania glass and are 0.16 to 0.19mm thick....
...
Experion spin filters are used to filter the gel matrix and gel stain solution prior to use with the Experion automated electrophoresis system. Supplied as 10 spin filters....
Biology Products:
(Date:7/9/2014)... Atlas (TCGA) Research Network have identified novel mutations ... the most common subtype of lung cancer. Knowledge ... of possible therapeutic targets for this disease and ... treatable mutations because many potent cancer drugs that ... jointly funded and managed by the National Cancer ...
(Date:7/9/2014)... that can attack soybean crops, why would charcoal rot ... University of Illinois scientists cite the earth,s changing climate ... the fungus that causes charcoal rot. , Fungi may ... Macrophomina phaseolina , the fungus that causes charcoal ... the climate continues to change and we see more ...
(Date:7/9/2014)... with pain and fever but often can be defeated with ... and hard to beat. Now, scientists have built a new ... pyramids. Published in the journal ACS Applied Materials & ... and kill more of them than medicine alone. , David ... can lie in wait, undetectable in the human body or ...
Breaking Biology News(10 mins):Study identifies novel genomic changes in the most common type of lung cancer 2Study identifies novel genomic changes in the most common type of lung cancer 3Climate change provides good growing conditions for charcoal rot in soybeans 2Climate change provides good growing conditions for charcoal rot in soybeans 3
... North Hollywood, CA August 13, 2009 - The ... and support for myeloma patients, families, researchers and physicianstoday ... link between environmental toxins and bone disease in multiple ... of cells in the bone marrow that affect production ...
... the splendidly colorful leaves adorning the trees are a delight ... yellow, while the United States and East Asia boast lustrous ... differences in autumnal hues around the world? A new theory ... Education- Biology at the University of Haifa-Oranim and Prof. Jarmo ...
... deaths has declined steadily in the last three decades. ... age groups have shown some improvement, according to a ... of the American Association for Cancer Research. ... better treatment, have resulted in profound gains, but these ...
Cached Biology News:New study suggests possible genetic links between environmental toxins and multiple myeloma 2Why are autumn leaves red in America and yellow in Europe? 2Why are autumn leaves red in America and yellow in Europe? 3Cancer mortality rates experience steady decline 2
(Date:1/15/2014)... January 15, 2014 The Microcompetition with Foreign ... disease. One of these latent viruses is the Epstein Barr ... (RA). Rheumatoid arthritis (RA) is a chronic inflammatory disease that ... study found that RA patients have high concentrations of EBV ...
(Date:1/15/2014)... Sunnyvale, CA (PRWEB) January 15, 2014 ... throughput research solutions, today announced that Lupin Limited, one ... of Freeslate’s CM Protégé PharmD System for ... in Mumbai, India, is focused on a wide range ...
(Date:1/14/2014)... Date: Friday, April 11, 2014 , Time: 6 p.m. ... Road, Warrington, Pa. , Details: The Hepatitis B ... a cure for hepatitis B and improving the quality of ... Ball on Friday, April 11 at Warrington Country Club in ...
(Date:1/14/2014)... provider of strategic communications services to corporations and organizations preparing for ... United States and Europe , today ... to the firm,s Washington, D.C. office. ... years of service as Associate Commissioner for the Office of External ...
Breaking Biology Technology:Study: Rheumatoid Arthritis (RA) Patients Have EBV; The CBCD Says this is Consistent with Microcompetition 2Study: Rheumatoid Arthritis (RA) Patients Have EBV; The CBCD Says this is Consistent with Microcompetition 3Lupin Selects Freeslate’s CM Protégé PharmD System to Accelerate Polymorph Screening for Drug Development 2Lupin Selects Freeslate’s CM Protégé PharmD System to Accelerate Polymorph Screening for Drug Development 3Hepatitis B Foundation to Host Annual Crystal Ball Gala 2Former FDA Associate Commissioner Returns To 3D Communications 2