Navigation Links
Mouse Anti-MAK Monoclonal Antibody, Unconjugated, Clone 4E9 from Abnova Corporation

ProductsMouse Anti-MAK Monoclonal Antibody, Unconjugated, Clone 4E9 from Abnova Corporation
Company Abnova Corporation
Item Mouse Anti-MAK Monoclonal Antibody, Unconjugated, Clone 4E9
Price 
Description Mouse monoclonal antibody raised against a partial recombinant MAK.
Immunogen: MAK (AAH39825, 358 a.a. ~ 457 a.a) partial recombinant protein with GST tag.
Protein Sequence: PPKQQSQEKPPQTLFPSIVKNMPTKPNGTLSHKSGRRRWGQTIFKSGDSWEELEDYDFGASHSKKPSMGVFKEKRKKDSPFRQQVKMAVISLSAHQFPTL
Accession: BC039825
Protein Accession Number: AAH39825
OMIM: 154235,
GeneID: 4117
Lot Number: MM951100652
MA Code: ABVAP914S
Operation Date: 2006/12/22
Info Abnova CorporationAbnova Corporation
Abnova Corporation (HQ)
9th Fl., No. 108, Jhouzih St.
Neihu District, Taipei
114 Taiwan R.O.C.
Tel: +886-2-8751-1888
Fax: +886-2-8751-1166

Abnova GmbH
Boxbergring 107
69126 Heidelberg
Germany
Tel: +49 6221 3632226
Fax: +49 6221 825878

Customer Service: +886-2-8751-1888
Fax Number: +886-2-8751-1166
Web Site: http://www.abnova.com.tw
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Mouse Anti-Amodiaquine Monoclonal Antibody, Unconjugated, Clone 6D10 from AntibodyShop A/S
2. Mouse Anti-Protein S Monoclonal Antibody, Unconjugated, Clone HYB 232-02 from Abcam
3. Mouse Anti-Mouse Glutathione S-transferase M1 (GSTM1) Monoclonal Antibody, Unconjugated from Lifespan Biosciences
4. Mouse Anti-Human S-100 alpha/beta chain Monoclonal Antibody, Unconjugated, Clone 8B10 from Santa Cruz Biotechnology, Inc.
5. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Testis from OriGene Technologies
6. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Brain (adult) from OriGene Technologies
7. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (12.5 - day) from OriGene Technologies
8. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (19 - day) from OriGene Technologies
9. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Thymus from OriGene Technologies
10. Mouse Anti-Human Complement factor B Monoclonal Antibody, Unconjugated, Clone 9B6 from AntibodyShop A/S
11. Mouse Anti-Human Choriongonadotropin (hCG) Monoclonal Antibody, Unconjugated, Clone 5F10 from AntibodyShop A/S
Tight junctions are complexes of proteins that create intercellular boundaries between the plasma membrane domains of epithelial and endothelial cells. Antigen: Synthetic peptide corresponding to...
Polyclonal Antibody to TRIB1/ SKIP1/ Tribbles 1...
TNF-Related Apoptosis Inducing Ligand-Receptor-1...
PMA (YPMA-1)...
Biology Products:
(Date:12/15/2016)... , Dec 15, 2016 ... Research and Markets has announced the ... their offering. The report forecasts the global military biometrics ... The report has been prepared based on an in-depth ... landscape and its growth prospects over the coming years. The report also ...
(Date:12/12/2016)... 12, 2016  Researchers at Trinity College, Dublin, ... by combining the material with Silly Putty. The mixture ... detector able to sense pulse, blood pressure, respiration, ... The research team,s findings were ... here:  http://science.sciencemag.org/content/354/6317/1257 ...
(Date:12/7/2016)... , December 7, 2016 BioCatch , the ... of its patent portfolio, which grew to over 40 granted and pending ... , , ... filed patent entitled " System, Device, and Method Estimating Force ... enables device makers to forego costly hardware components needed to estimate the ...
Breaking Biology News(10 mins):
(Date:1/19/2017)... PUNE, India , Jan. 19, 2017  Market Research Future ... The Global Market for Liquid Biopsy is growing rapidly and expected ... period. Market Highlights ... The Global Liquid Biopsy Market has been assessed as ... high growth figures and boom in the coming future. There has ...
(Date:1/19/2017)... , Jan 19, 2017 Research and Markets ... has announced the addition of the ... Application - Forecast to 2025" report to their offering. ... The report provides a detailed analysis on current and future ... till 2025, using estimated market values as the base numbers ...
(Date:1/19/2017)... and GAITHERSBURG, Md. ... MKT: PIP) and Altimmune, Inc., a privately-held immunotherapeutics ... of a definitive agreement for the merger of ... current investors include Novartis Venture Fund, HealthCap, Truffle ... be a fully-integrated and diversified immunotherapeutics company with ...
(Date:1/19/2017)... ... January 18, 2017 , ... The American Medical Informatics ... its Data Sharing Policy. Specifically, the nation’s leading informatics experts, said data sharing ... existing policy. AMIA recommended that NIH earmark funding for researchers to produce and ...
Breaking Biology Technology: