Navigation Links
Mouse Anti-MAK Monoclonal Antibody, Unconjugated, Clone 4E9 from Abnova Corporation

ProductsMouse Anti-MAK Monoclonal Antibody, Unconjugated, Clone 4E9 from Abnova Corporation
Company Abnova Corporation
Item Mouse Anti-MAK Monoclonal Antibody, Unconjugated, Clone 4E9
Price 
Description Mouse monoclonal antibody raised against a partial recombinant MAK.
Immunogen: MAK (AAH39825, 358 a.a. ~ 457 a.a) partial recombinant protein with GST tag.
Protein Sequence: PPKQQSQEKPPQTLFPSIVKNMPTKPNGTLSHKSGRRRWGQTIFKSGDSWEELEDYDFGASHSKKPSMGVFKEKRKKDSPFRQQVKMAVISLSAHQFPTL
Accession: BC039825
Protein Accession Number: AAH39825
OMIM: 154235,
GeneID: 4117
Lot Number: MM951100652
MA Code: ABVAP914S
Operation Date: 2006/12/22
Info Abnova CorporationAbnova Corporation
Abnova Corporation (HQ)
9th Fl., No. 108, Jhouzih St.
Neihu District, Taipei
114 Taiwan R.O.C.
Tel: +886-2-8751-1888
Fax: +886-2-8751-1166

Abnova GmbH
Boxbergring 107
69126 Heidelberg
Germany
Tel: +49 6221 3632226
Fax: +49 6221 825878

Customer Service: +886-2-8751-1888
Fax Number: +886-2-8751-1166
Web Site: http://www.abnova.com.tw
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Mouse Anti-Amodiaquine Monoclonal Antibody, Unconjugated, Clone 6D10 from AntibodyShop A/S
2. Mouse Anti-Protein S Monoclonal Antibody, Unconjugated, Clone HYB 232-02 from Abcam
3. Mouse Anti-Mouse Glutathione S-transferase M1 (GSTM1) Monoclonal Antibody, Unconjugated from Lifespan Biosciences
4. Mouse Anti-Human S-100 alpha/beta chain Monoclonal Antibody, Unconjugated, Clone 8B10 from Santa Cruz Biotechnology, Inc.
5. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Testis from OriGene Technologies
6. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Brain (adult) from OriGene Technologies
7. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (12.5 - day) from OriGene Technologies
8. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (19 - day) from OriGene Technologies
9. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Thymus from OriGene Technologies
10. Mouse Anti-Human Complement factor B Monoclonal Antibody, Unconjugated, Clone 9B6 from AntibodyShop A/S
11. Mouse Anti-Human Choriongonadotropin (hCG) Monoclonal Antibody, Unconjugated, Clone 5F10 from AntibodyShop A/S
... Source: Bacillus globigii 5'GCCNNNN NGGC3' 3'CGGN ... for 15 min or phenol treatment followed ... (pH 8.0), 200mM KCl, 0.1mM EDTA, 1.0mM ... Storage: Shipped on dry ice. Store at ...
...
Anti-Tissue Trans-glutaminase (IgA) EIA Sample Size: 10 l...
... EnzChek Lysozyme Assay Kit (E-22013) provides,researchers ... levels of lysozyme,activity in solution. This ... to 20 U/mL (Figure 1). The ... cell,walls, which are labeled to such ...
Biology Products:
(Date:4/13/2017)... According to a new market research report "Consumer ... Administration, and Authorization), Service, Authentication Type, Deployment Mode, Vertical, and Region - ... to grow from USD 14.30 Billion in 2017 to USD 31.75 Billion ... ... MarketsandMarkets Logo ...
(Date:4/11/2017)... DUBLIN , Apr. 11, 2017 Research ... Tracking Market 2017-2021" report to their offering. ... The global eye tracking market to grow at ... The report, Global Eye Tracking Market 2017-2021, has been prepared based ... report covers the market landscape and its growth prospects over the ...
(Date:4/11/2017)... , April 11, 2017 NXT-ID, Inc. ... technology company, announces the appointment of independent Directors Mr. ... to its Board of Directors, furthering the company,s corporate governance ... Gino ... we look forward to their guidance and benefiting from their ...
Breaking Biology News(10 mins):
(Date:5/23/2017)... ... May 23, 2017 , ... ... file transfer solution that makes it easy for organizations to send and gather ... about cumbersome FTP software or email file size limitations. , Using the ...
(Date:5/23/2017)... (PRWEB) , ... May 22, 2017 , ... ... and Photonics 2017 in San Diego, California, this August will feature high-level ... fuels, and autonomous vehicles. , SPIE Optics and Photonics, the largest multidisciplinary optical ...
(Date:5/23/2017)... ... May 23, 2017 , ... Cambridge Semantics , the leading ... year’s Bio-IT World Conference and Expo in Boston May 23-25 with a ... The Anzo Smart Data Lake is also a finalist for the Best of ...
(Date:5/21/2017)... , ... May 19, 2017 , ... ... and educational conference of the American Association of Bioanalysts (AAB) and the College ... in Houston. The conference reinforces AAB’s commitment to excellence in clinical laboratory services ...
Breaking Biology Technology: