Navigation Links
Mouse Anti-MAK Monoclonal Antibody, Unconjugated, Clone 4E9 from Abnova Corporation

ProductsMouse Anti-MAK Monoclonal Antibody, Unconjugated, Clone 4E9 from Abnova Corporation
Company Abnova Corporation
Item Mouse Anti-MAK Monoclonal Antibody, Unconjugated, Clone 4E9
Price 
Description Mouse monoclonal antibody raised against a partial recombinant MAK.
Immunogen: MAK (AAH39825, 358 a.a. ~ 457 a.a) partial recombinant protein with GST tag.
Protein Sequence: PPKQQSQEKPPQTLFPSIVKNMPTKPNGTLSHKSGRRRWGQTIFKSGDSWEELEDYDFGASHSKKPSMGVFKEKRKKDSPFRQQVKMAVISLSAHQFPTL
Accession: BC039825
Protein Accession Number: AAH39825
OMIM: 154235,
GeneID: 4117
Lot Number: MM951100652
MA Code: ABVAP914S
Operation Date: 2006/12/22
Info Abnova CorporationAbnova Corporation
Abnova Corporation (HQ)
9th Fl., No. 108, Jhouzih St.
Neihu District, Taipei
114 Taiwan R.O.C.
Tel: +886-2-8751-1888
Fax: +886-2-8751-1166

Abnova GmbH
Boxbergring 107
69126 Heidelberg
Germany
Tel: +49 6221 3632226
Fax: +49 6221 825878

Customer Service: +886-2-8751-1888
Fax Number: +886-2-8751-1166
Web Site: http://www.abnova.com.tw
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Mouse Anti-Amodiaquine Monoclonal Antibody, Unconjugated, Clone 6D10 from AntibodyShop A/S
2. Mouse Anti-Protein S Monoclonal Antibody, Unconjugated, Clone HYB 232-02 from Abcam
3. Mouse Anti-Mouse Glutathione S-transferase M1 (GSTM1) Monoclonal Antibody, Unconjugated from Lifespan Biosciences
4. Mouse Anti-Human S-100 alpha/beta chain Monoclonal Antibody, Unconjugated, Clone 8B10 from Santa Cruz Biotechnology, Inc.
5. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Testis from OriGene Technologies
6. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Brain (adult) from OriGene Technologies
7. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (12.5 - day) from OriGene Technologies
8. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (19 - day) from OriGene Technologies
9. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Thymus from OriGene Technologies
10. Mouse Anti-Human Complement factor B Monoclonal Antibody, Unconjugated, Clone 9B6 from AntibodyShop A/S
11. Mouse Anti-Human Choriongonadotropin (hCG) Monoclonal Antibody, Unconjugated, Clone 5F10 from AntibodyShop A/S
... I catalyzes the template-directed polymerization of nucleotides ... DNA Polymerase I possesses a 3?5 exonuclease ... error rate during DNA replication, and also ... the enzyme to replace nucleotides in the ...
... genetically engineered Klenow polymerase in which the 3 ... only the 5 to 3 polymerase activity. The ... the enzyme of choice for isotopic or biotin ... method, and for DNA sequencing by the Sanger ...
Request Info...
DNA polymerase I, large fragment...
Biology Products:
(Date:11/17/2016)... 2016 Global Market Watch: Primarily supported ... Population-Based Banks and Academics) market is to witness a value ... shows the highest Compounded Annual Growth Rate (CAGR) of 10.75% ... the analysis period 2014-2020. North America ... by Europe at 9.56% respectively. ...
(Date:11/15/2016)... Nov. 15, 2016  Synthetic Biologics, Inc. (NYSE ... focused on the gut microbiome, today announced the ... shares of its common stock and warrants to ... a price to the public of $1.00 per ... Biologics from the offering, excluding the proceeds, if ...
(Date:11/14/2016)... , Nov. 14, 2016  Based ... identification market, Frost & Sullivan recognizes FST ... Sullivan Award for Visionary Innovation Leadership. FST ... the biometric identification market by pioneering In ... solution for instant, seamless, and non-invasive verification. ...
Breaking Biology News(10 mins):
(Date:12/2/2016)... ... December 01, 2016 , ... ACEA Biosciences, Inc. announced today that it will ... AC0010 at the World Conference on Lung Cancer 2016, taking place in Vienna, Austria ... I/II clinical trials for AC0010 in patients with advanced non-small cell lung cancer harboring ...
(Date:12/2/2016)... ... December 01, 2016 , ... Aerocom Healthcare ( ... hospitals, will present its chain-of-custody solution for tracking and securing medications at booth ... Dec. 4-8, 2016. , Aerocom has a proven solution for tracking medications via ...
(Date:12/2/2016)... ... 2016 , ... The Conference Forum has announced that the 3rd annual ... on February 1-3, 2017 at the Roosevelt Hotel in New York City. Led by ... unique 360-degree approach, which addresses the most up-to-date information regarding business aspects, clinical advancements ...
(Date:12/2/2016)... ... December 01, 2016 , ... Orthogonal, ... on their recent FDA Class II 510(k) clearance for their flagship medical device, ... commercializing remote cardiac monitoring devices that rely on cloth-based nanosensors. While other companies ...
Breaking Biology Technology: