Navigation Links
Mouse Anti-Human Melanoma gp100 Monoclonal Antibody, Unconjugated, Clone SPM142 from ABR-Affinity BioReagents

ProductsMouse Anti-Human Melanoma gp100 Monoclonal Antibody, Unconjugated, Clone SPM142 from ABR-Affinity BioReagents
Company ABR-Affinity BioReagents
Item Mouse Anti-Human Melanoma gp100 Monoclonal Antibody, Unconjugated, Clone SPM142
Price $320.00
Description Immunogen: Extract of pigmented melanoma metastases from lymph nodes.
Storage: -20 C, Avoid Freeze/Thaw Cycles
Info ABR-Affinity BioReagentsABR-Affinity BioReagents
ABR-Affinity BioReagents Inc.
4620 Technology Drive, Suite 600
Golden, CO 80403
USA

Customer Service: +1.800.527.4535
Fax Number: +1.303.278.2424
Web Site: http://www.bioreagents.com
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Mouse Anti-Amodiaquine Monoclonal Antibody, Unconjugated, Clone 6D10 from AntibodyShop A/S
2. Mouse Anti-Protein S Monoclonal Antibody, Unconjugated, Clone HYB 232-02 from Abcam
3. Mouse Anti-Mouse Glutathione S-transferase M1 (GSTM1) Monoclonal Antibody, Unconjugated from Lifespan Biosciences
4. Mouse Anti-Human S-100 alpha/beta chain Monoclonal Antibody, Unconjugated, Clone 8B10 from Santa Cruz Biotechnology, Inc.
5. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Testis from OriGene Technologies
6. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Brain (adult) from OriGene Technologies
7. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (12.5 - day) from OriGene Technologies
8. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (19 - day) from OriGene Technologies
9. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Thymus from OriGene Technologies
10. Mouse Anti-Human Complement factor B Monoclonal Antibody, Unconjugated, Clone 9B6 from AntibodyShop A/S
11. Mouse Anti-Human Choriongonadotropin (hCG) Monoclonal Antibody, Unconjugated, Clone 5F10 from AntibodyShop A/S
Mouse monoclonal antibody raised against a full length recombinant SNAPC5. NCBI Entrez Gene ID = SNAPC5...
Agarose II (Low Melt)...
... monoclonal antibody raised against a partial recombinant NFKBIB. ... a.a. ~ 145 a.a) partial recombinant protein with ... EDGDTALHLAVIHQHEPFLDFLLGFSAGTEYMDLQNDLGQTALHLAAILGETSTVEKLYAAGAGLCVAERRGHTALHLACRVGAHACARA Accession: BC015528 ... OMIM: 604495, ...
Mouse monoclonal antibody raised against a partial recombinant CRKRS. NCBI Entrez Gene ID = CRKRS...
Biology Products:
(Date:8/23/2017)... general public,s help is being enlisted in what,s thought to be the ... the human body –and are believed to affect health.  ... The Microbiome Immunity Project is the largest study to ... The project's goal is to help advance scientific knowledge of the role ... The ...
(Date:7/20/2017)... -- Delta (NYSE: DAL ) customers now can use fingerprints ... Washington National Airport (DCA). ... Delta launches biometrics to board aircraft at Reagan Washington National ... Delta,s biometric boarding pass experience that launched ... into the boarding process to allow eligible Delta SkyMiles Members who are ...
(Date:6/23/2017)... ARMONK, N.Y. and ITHACA, N.Y. ... IBM ) and Cornell University, a leader in dairy ... combined with bioinformatics designed to help reduce the chances ... breaches. With the onset of this dairy project, Cornell ... the Consortium for Sequencing the Food Supply Chain, a ...
Breaking Biology News(10 mins):
(Date:10/10/2017)... CA (PRWEB) , ... October ... ... a development-stage cancer-focused pharmaceutical company advancing targeted antibody-drug conjugate (ADC) therapeutics, today ... of targeted HPLN (Hybrid Polymerized Liposomal Nanoparticle), a technology developed in collaboration ...
(Date:10/10/2017)... ... , ... Dr. Bob Harman, founder and CEO of VetStem Biopharma, Inc. ... The event entitled “Stem Cells and Their Regenerative Powers,” was held on August ... MPVM was joined by two human doctors: Peter B. Hanson, M.D., Chief of Orthopedic ...
(Date:10/10/2017)... SANTA CRUZ, Calif. , Oct. 10, 2017 /PRNewswire/ ... SBIR grant from the NIH to develop RealSeq®-SC (Single ... preparation kit for profiling small RNAs (including microRNAs) from ... Cell Analysis Program highlights the need to accelerate development ... "New techniques for ...
(Date:10/10/2017)... ... October 10, 2017 , ... The Pittcon Program Committee is ... honoring scientists who have made outstanding contributions to analytical chemistry and applied spectroscopy. ... world’s leading conference and exposition for laboratory science, which will be held February ...
Breaking Biology Technology: