Mouse Anti-Human Choriongonadotropin (hCG) Monoclonal Antibody, Unconjugated, Clone 5F10 from AntibodyShop A/S

... against a partial recombinant FES. ... ~ 250 a.a) partial recombinant protein with ... WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA Accession: ... AAH35357 OMIM: ...

... raised against a partial recombinant ... PPP4C (NP_002711, 218 a.a. ... protein with GST tag. ... NM_002720 Protein ...

Mouse monoclonal antibody raised against a partial recombinant CAPG. NCBI Entrez Gene ID = CAPG...

...

Biology Products:

Mouse Anti-FES Polyclonal Antibody, Unconjugated from Abnova Corporation Mouse Anti-PPP4C Polyclonal Antibody, Unconjugated from Abnova Corporation Mouse Anti-Human CAPG Monoclonal Antibody, Unconjugated, Clone 6D6 from Abnova Corporation GeneSnap from SYNGENE

(Date:2/13/2020)... ... February 13, 2020 , ... ... with Nobio CEO Yoram Ashery to discuss how their revolutionary technology ... that combats bacteria to keep people healthy with their revolutionary nanoparticle technology. Nobio ...

(Date:2/10/2020)... ... 2020 , ... A Worcester Polytechnic Institute (WPI) bioinformatics researcher ... a major development that potentially holds the key to understanding the spread and ... the Wuhan coronavirus made available on the National Center for Biotechnology Information ...

(Date:2/5/2020)... ... February 04, 2020 , ... Crystal Diagnostics (CDx) ... a second patent related to proprietary liquid crystal technology for rapid and accurate ... the USPTO issued on December 3, 2019. Together, these patents protect the company’s ...

Breaking Biology News(10 mins):

[0] Worldwide Business with kathy ireland®: See Nobio Introduce Their Breakthrough Antibacterial Technology That Helps Prevent Infections [0] WPI Researcher Shares 3D Roadmap of Coronavirus with Scientists Worldwide [0] Crystal Diagnostics Granted New Patent for Rapid Detection of Foodborne Pathogens

(Date:2/19/2020)... ... February 18, 2020 , ... ... characterizing microbiome populations down to the strain level, recently unveiled a novel DNA ... for efficient and unbiased isolation of high molecular weight (HMW) single-stranded DNA (ssDNA) ...

(Date:2/19/2020)... ... February 19, 2020 , ... Red ... life sciences industry, today announced the opening of a new office in Tokyo, ... Nucleus R&D. , Red Nucleus announced the new office in response to customer ...

(Date:2/11/2020)... ... February 11, 2020 , ... ... announce the successful results from a long-term follow-up clinical study of outpatient ... fixation device (INSPAN LLC). Unlike extension block design, the Inspan device fixates ...

(Date:2/10/2020)... , ... February 10, 2020 , ... R3 Medical Training ... March 13-14th, 2020 in Las Vegas. The course is hands on involving real ... For the past few years, the Comprehensive Stem Cell Training Course has received rave ...

Breaking Biology Technology:

[0] Shoreline Biome Launches New DNA Isolation Product, Shoreline Rapid Prep [0] Red Nucleus Opens Japan Office [0] 5-Year Follow-Up Outpatient of L4-L5 Fixation with Inspan Device for Degenerative Spinal Stenosis Demonstrates Improved Results [0] R3 Medical Training Announces Next Comprehensive Stem Cell Training Course Set for March 13-14 2020 in Las Vegas

Products	Mouse Anti-Human Choriongonadotropin (hCG) Monoclonal Antibody, Unconjugated, Clone 5F10 from AntibodyShop A/S
Company	AntibodyShop A/S
Item	Mouse Anti-Human Choriongonadotropin (hCG) Monoclonal Antibody, Unconjugated, Clone 5F10
Price
Description	Choriongonadotropin (human, hCG)
Info	AntibodyShop A/S Grusbakken 8 DK-2820 Gentofte Denmark Customer Service: (+45) 4529 0000 Fax Number: (+45) 4529 0001 Web Site: http://www.antibodyshop.com