Navigation Links
Mouse Anti-Human Choriongonadotropin (hCG) Monoclonal Antibody, Unconjugated, Clone 5F10 from AntibodyShop A/S

ProductsMouse Anti-Human Choriongonadotropin (hCG) Monoclonal Antibody, Unconjugated, Clone 5F10 from AntibodyShop A/S
Company AntibodyShop A/S
Item Mouse Anti-Human Choriongonadotropin (hCG) Monoclonal Antibody, Unconjugated, Clone 5F10
Price 
Description Choriongonadotropin (human, hCG)
Info AntibodyShop A/SAntibodyShop A/S
Grusbakken 8
DK-2820 Gentofte
Denmark
Customer Service: (+45) 4529 0000
Fax Number: (+45) 4529 0001
Web Site: http://www.antibodyshop.com
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Mouse Anti-Amodiaquine Monoclonal Antibody, Unconjugated, Clone 6D10 from AntibodyShop A/S
2. Mouse Anti-Protein S Monoclonal Antibody, Unconjugated, Clone HYB 232-02 from Abcam
3. Mouse Anti-Mouse Glutathione S-transferase M1 (GSTM1) Monoclonal Antibody, Unconjugated from Lifespan Biosciences
4. Mouse Anti-Human S-100 alpha/beta chain Monoclonal Antibody, Unconjugated, Clone 8B10 from Santa Cruz Biotechnology, Inc.
5. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Testis from OriGene Technologies
6. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Brain (adult) from OriGene Technologies
7. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (12.5 - day) from OriGene Technologies
8. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (19 - day) from OriGene Technologies
9. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Thymus from OriGene Technologies
10. Mouse Anti-Human Complement factor B Monoclonal Antibody, Unconjugated, Clone 9B6 from AntibodyShop A/S
11. Mouse Anti-Glucagon-like peptide-1 (GLP-1 (1-36) amide) Monoclonal Antibody, Unconjugated, Clone 9F8 from AntibodyShop A/S
... against a partial recombinant FES. ... ~ 250 a.a) partial recombinant protein with ... WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA Accession: ... AAH35357 OMIM: ...
... raised against a partial recombinant ... PPP4C (NP_002711, 218 a.a. ... protein with GST tag. ... NM_002720 Protein ...
Mouse monoclonal antibody raised against a partial recombinant CAPG. NCBI Entrez Gene ID = CAPG...
...
Biology Products:
(Date:2/13/2020)... ... February 13, 2020 , ... ... with Nobio CEO Yoram Ashery to discuss how their revolutionary technology ... that combats bacteria to keep people healthy with their revolutionary nanoparticle technology. Nobio ...
(Date:2/10/2020)... ... 2020 , ... A Worcester Polytechnic Institute (WPI) bioinformatics researcher ... a major development that potentially holds the key to understanding the spread and ... the Wuhan coronavirus made available on the National Center for Biotechnology Information ...
(Date:2/5/2020)... ... February 04, 2020 , ... Crystal Diagnostics (CDx) ... a second patent related to proprietary liquid crystal technology for rapid and accurate ... the USPTO issued on December 3, 2019. Together, these patents protect the company’s ...
Breaking Biology News(10 mins):
(Date:2/19/2020)... ... February 18, 2020 , ... ... characterizing microbiome populations down to the strain level, recently unveiled a novel DNA ... for efficient and unbiased isolation of high molecular weight (HMW) single-stranded DNA (ssDNA) ...
(Date:2/19/2020)... ... February 19, 2020 , ... Red ... life sciences industry, today announced the opening of a new office in Tokyo, ... Nucleus R&D. , Red Nucleus announced the new office in response to customer ...
(Date:2/11/2020)... ... February 11, 2020 , ... ... announce the successful results from a long-term follow-up clinical study of outpatient ... fixation device (INSPAN LLC). Unlike extension block design, the Inspan device fixates ...
(Date:2/10/2020)... , ... February 10, 2020 , ... R3 Medical Training ... March 13-14th, 2020 in Las Vegas. The course is hands on involving real ... For the past few years, the Comprehensive Stem Cell Training Course has received rave ...
Breaking Biology Technology: