Navigation Links
Mouse Anti-HD Monoclonal Antibody, Unconjugated, Clone 3D6 from Abnova Corporation

ProductsMouse Anti-HD Monoclonal Antibody, Unconjugated, Clone 3D6 from Abnova Corporation
Company Abnova Corporation
Item Mouse Anti-HD Monoclonal Antibody, Unconjugated, Clone 3D6
Price 
Description Mouse monoclonal antibody raised against a partial recombinant HD.
Immunogen: HD (NP_002102, 81 a.a. ~ 191 a.a) partial recombinant protein with GST tag.
Accession Number: NM_002111
Protein Sequence: AVAEEPLHRPKKELSATKKDRVNHCLTICENIVAQSVRNSPEFQKLLGIAMELFLLCSDDAESDVRMVADECLNKVIKALMDSNLPRLQLELYKEIKKNGAPRSLRAALW*
Info Abnova CorporationAbnova Corporation
Abnova Corporation (HQ)
9th Fl., No. 108, Jhouzih St.
Neihu District, Taipei
114 Taiwan R.O.C.
Tel: +886-2-8751-1888
Fax: +886-2-8751-1166

Abnova GmbH
Boxbergring 107
69126 Heidelberg
Germany
Tel: +49 6221 3632226
Fax: +49 6221 825878

Customer Service: +886-2-8751-1888
Fax Number: +886-2-8751-1166
Web Site: http://www.abnova.com.tw
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Mouse Anti-Amodiaquine Monoclonal Antibody, Unconjugated, Clone 6D10 from AntibodyShop A/S
2. Mouse Anti-Protein S Monoclonal Antibody, Unconjugated, Clone HYB 232-02 from Abcam
3. Mouse Anti-Mouse Glutathione S-transferase M1 (GSTM1) Monoclonal Antibody, Unconjugated from Lifespan Biosciences
4. Mouse Anti-Human S-100 alpha/beta chain Monoclonal Antibody, Unconjugated, Clone 8B10 from Santa Cruz Biotechnology, Inc.
5. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Testis from OriGene Technologies
6. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Brain (adult) from OriGene Technologies
7. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (12.5 - day) from OriGene Technologies
8. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (19 - day) from OriGene Technologies
9. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Thymus from OriGene Technologies
10. Mouse Anti-Human Complement factor B Monoclonal Antibody, Unconjugated, Clone 9B6 from AntibodyShop A/S
11. Mouse Anti-Human Choriongonadotropin (hCG) Monoclonal Antibody, Unconjugated, Clone 5F10 from AntibodyShop A/S
Recombinant Mouse TGF-beta RII/(human) Fc Chimera, CF...
Recombinant Mouse Noggin...
... Histone Deacetylase (HDAC) Antibody Sampler Kit ... (HDAC1) Antibody, Catalog #2062, 40 ul Histone ... ul Histone Deacetylase 4 (HDAC4) Antibody, Catalog ... Antibody, Catalog #2082, 40 ul Histone Deacetylase ...
An instrument that delivers an accurate and uniform amount of light energy to cells to photoactivate csiRNA products....
Biology Products:
(Date:2/28/2017)... News solutions for biometrics, bag drop and New ADA-compliant ... At PTE ... March, Materna will present its complete end-to-end passenger journey, ... real benefit for passengers. To accelerate the whole passenger handling ... solutions to take passengers through the complete integrated process with ...
(Date:2/27/2017)... , Feb. 27, 2017   Strategic Cyber Ventures ... it has led a $3.5 million investment in  Polarity ... Strategic Cyber Ventures is DC based and is led ... Hank Thomas . Ron Gula , also a ... also participated in this series A round of funding. ...
(Date:2/24/2017)... BARCELONA, Spain , Feb. 24, 2017  EyeLock LLC, ... will demonstrate its elite iris biometric solution on ... with X16 LTE at Mobile World Congress ... in Qualcomm,s Booth in Hall 3, Stand ... contains the Qualcomm Haven™ security platform—a combination ...
Breaking Biology News(10 mins):
(Date:3/22/2017)... Oramed Pharmaceuticals Inc. (NASDAQ: ... ), a clinical-stage pharmaceutical company focused on ... today that Dr. Miriam Kidron , Oramed,s ... "Oral Insulin for Diabetes Treatment: Bypassing the Roadblock," ... Peptide Therapeutics (OPT) Boston Conference in Cambridge, ...
(Date:3/22/2017)... 22, 2017   Boston Biomedical , an industry ... to target cancer stemness pathways, today announced its Board ... as Chief Executive Officer, effective April 24, 2017. ... Li , M.D., FACP, who has led Boston Biomedical ... his leadership, Boston Biomedical has grown from a "garage ...
(Date:3/22/2017)... Maryland (PRWEB) , ... March 21, 2017 , ... ... Life Science Chief Executive Officer Forum on March 23-24 in San Diego. The ... medical device and diagnostic industries. , Benchworks Vice President Christian Meyer will also ...
(Date:3/22/2017)... ... ... The Society for Immunotherapy of Cancer (SITC) strongly opposes the proposed budget cuts ... 2018 budget request. , This proposal calls for a reduction in ... of its total budget. If applied proportionally across NIH, funding for the National Cancer ...
Breaking Biology Technology: