Navigation Links
Mouse Anti-HD Monoclonal Antibody, Unconjugated, Clone 3D6 from Abnova Corporation

ProductsMouse Anti-HD Monoclonal Antibody, Unconjugated, Clone 3D6 from Abnova Corporation
Company Abnova Corporation
Item Mouse Anti-HD Monoclonal Antibody, Unconjugated, Clone 3D6
Price 
Description Mouse monoclonal antibody raised against a partial recombinant HD.
Immunogen: HD (NP_002102, 81 a.a. ~ 191 a.a) partial recombinant protein with GST tag.
Accession Number: NM_002111
Protein Sequence: AVAEEPLHRPKKELSATKKDRVNHCLTICENIVAQSVRNSPEFQKLLGIAMELFLLCSDDAESDVRMVADECLNKVIKALMDSNLPRLQLELYKEIKKNGAPRSLRAALW*
Info Abnova CorporationAbnova Corporation
Abnova Corporation (HQ)
9th Fl., No. 108, Jhouzih St.
Neihu District, Taipei
114 Taiwan R.O.C.
Tel: +886-2-8751-1888
Fax: +886-2-8751-1166

Abnova GmbH
Boxbergring 107
69126 Heidelberg
Germany
Tel: +49 6221 3632226
Fax: +49 6221 825878

Customer Service: +886-2-8751-1888
Fax Number: +886-2-8751-1166
Web Site: http://www.abnova.com.tw
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Mouse Anti-Amodiaquine Monoclonal Antibody, Unconjugated, Clone 6D10 from AntibodyShop A/S
2. Mouse Anti-Protein S Monoclonal Antibody, Unconjugated, Clone HYB 232-02 from Abcam
3. Mouse Anti-Mouse Glutathione S-transferase M1 (GSTM1) Monoclonal Antibody, Unconjugated from Lifespan Biosciences
4. Mouse Anti-Human S-100 alpha/beta chain Monoclonal Antibody, Unconjugated, Clone 8B10 from Santa Cruz Biotechnology, Inc.
5. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Testis from OriGene Technologies
6. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Brain (adult) from OriGene Technologies
7. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (12.5 - day) from OriGene Technologies
8. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (19 - day) from OriGene Technologies
9. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Thymus from OriGene Technologies
10. Mouse Anti-Human Complement factor B Monoclonal Antibody, Unconjugated, Clone 9B6 from AntibodyShop A/S
11. Mouse Anti-Human Choriongonadotropin (hCG) Monoclonal Antibody, Unconjugated, Clone 5F10 from AntibodyShop A/S
... R4 is the lowest priced, full ring ... world. Despite the microPET R4 low ... in all performance categories; count rate performance, ... microPET is a dedicated small animal PET ...
... series offers versatile liquid handling platforms and ... wide variety of life science applications.The Freedom ... sizes (75, 100, 150 and 200 cm), ... platform that will advance with their application ...
...
... microPET 220 utilizes utilizies CTI Molecular ... to superior resolution, sensitivty, and a ... user the flexibility to image multiple ... quality., microPET is a dedicated small ...
Biology Products:
(Date:12/16/2016)... MIAMI , Dec. 16, 2016   ... intuitive Identity management products and solutions and a ... announced today that it is offering seamless, integrated ... Edam security entrance products. The solutions provide IdentyTech,s ... to secure their facilities from crime and theft. ...
(Date:12/15/2016)... VANCOUVER, Canada and BADEN-BADEN, Germany ... Solutions, a leading global financial services provider, today announced an ... in passive behavioural biometrics, to join forces. The partnership will ... fraud mitigation strategies in compliance with local data protection regulation. ... In ...
(Date:12/15/2016)... , Dec. 15, 2016 ... driving experience, health wellness and wellbeing (HWW), ... one in three new passenger vehicles begin ... recognition, gesture recognition, heart beat monitoring, brain ... monitoring, facial monitoring, and pulse detection. These ...
Breaking Biology News(10 mins):
(Date:1/24/2017)... 2017 According to a new ... (Genetic, Cell-based (CD34, PBMC, BLT)), Application (Neuroscience, Hematopoiesis, Oncology, ... Biotech Companies, CRO) - Global Forecast to 2021", published ... Model Market for the forecast period of 2016 to ... Million by 2021 from USD 73.3 Million in 2016, ...
(Date:1/23/2017)... Fl (PRWEB) , ... January 23, 2017 , ... ... venture-backed teleradiology and telemedicine company announces significant growth last year adding 65 new ... Veterans Authority and US Army medical centers as well as one of US ...
(Date:1/23/2017)... BATH, England , January 23, 2017 ... company, today announces completion of its Series D financing, raising ... and one new investor, Wondfo Biotech. ... Development of the Atlas Genetics ... of the Chlamydia trachomatis (CT) test announced in February 2016. ...
(Date:1/23/2017)... ... , ... CallTower is proud to announce that their hosted Skype ... winner for 2017. , For three consecutive years, CallTower has been recognized by ... awarded with the hosted VoIP Excellence award and in 2015, they received the Skype ...
Breaking Biology Technology: