Navigation Links
Mouse Anti-HD Monoclonal Antibody, Unconjugated, Clone 3D6 from Abnova Corporation

ProductsMouse Anti-HD Monoclonal Antibody, Unconjugated, Clone 3D6 from Abnova Corporation
Company Abnova Corporation
Item Mouse Anti-HD Monoclonal Antibody, Unconjugated, Clone 3D6
Price 
Description Mouse monoclonal antibody raised against a partial recombinant HD.
Immunogen: HD (NP_002102, 81 a.a. ~ 191 a.a) partial recombinant protein with GST tag.
Accession Number: NM_002111
Protein Sequence: AVAEEPLHRPKKELSATKKDRVNHCLTICENIVAQSVRNSPEFQKLLGIAMELFLLCSDDAESDVRMVADECLNKVIKALMDSNLPRLQLELYKEIKKNGAPRSLRAALW*
Info Abnova CorporationAbnova Corporation
Abnova Corporation (HQ)
9th Fl., No. 108, Jhouzih St.
Neihu District, Taipei
114 Taiwan R.O.C.
Tel: +886-2-8751-1888
Fax: +886-2-8751-1166

Abnova GmbH
Boxbergring 107
69126 Heidelberg
Germany
Tel: +49 6221 3632226
Fax: +49 6221 825878

Customer Service: +886-2-8751-1888
Fax Number: +886-2-8751-1166
Web Site: http://www.abnova.com.tw
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Mouse Anti-Amodiaquine Monoclonal Antibody, Unconjugated, Clone 6D10 from AntibodyShop A/S
2. Mouse Anti-Protein S Monoclonal Antibody, Unconjugated, Clone HYB 232-02 from Abcam
3. Mouse Anti-Mouse Glutathione S-transferase M1 (GSTM1) Monoclonal Antibody, Unconjugated from Lifespan Biosciences
4. Mouse Anti-Human S-100 alpha/beta chain Monoclonal Antibody, Unconjugated, Clone 8B10 from Santa Cruz Biotechnology, Inc.
5. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Testis from OriGene Technologies
6. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Brain (adult) from OriGene Technologies
7. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (12.5 - day) from OriGene Technologies
8. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (19 - day) from OriGene Technologies
9. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Thymus from OriGene Technologies
10. Mouse Anti-Human Complement factor B Monoclonal Antibody, Unconjugated, Clone 9B6 from AntibodyShop A/S
11. Mouse Anti-Human Choriongonadotropin (hCG) Monoclonal Antibody, Unconjugated, Clone 5F10 from AntibodyShop A/S
(Date:8/20/2014)... LAKE CITY Researchers at Huntsman Cancer Institute (HCI) at ... forms of the gene that encodes BCR-ABL, the unregulated ... According to the American Cancer Society, nearly 6,000 new ... Drugs already in use, called tyrosine kinase inhibitors (TKIs), ... They do not cure CML but control it in ...
(Date:8/20/2014)... University of Tbingen, Arizona State University, the Wellcome Trust ... Institute (Swiss TPH) isolated Mycobacterium pinnipedii from ... years old. The pathogen is a relative of the ... disease in humans today. These researchers assume that seals ... "The link to sea lions was unexpected" comments Sebastien ...
(Date:8/20/2014)... SILICON VALLEY, Calif., August 19, 2014 -- Bay Area ... to diagnose and simple to cure, applauds new research ... review journal Ticks and Tick-borne Diseases . ... in Northwest California are active throughout the year, making ... conducted by researchers at California Department of Public Health ...
Breaking Biology News(10 mins):Blueprint for next generation of chronic myeloid leukemia treatment 2Lyme disease risk is year-round in Northwest California, according to new study 2Lyme disease risk is year-round in Northwest California, according to new study 3
... A prototype drug created by researchers at the University ... of the virus responsible for severe acute respiratory syndrome, ... agents or vaccines for SARS, which killed almost 800 ... basis of their success, the researchers have received an ...
... of malaria is in prospect with a clinical drug trial ... in the trial would open the way to relief in ... fatal disease - over 500,000,000 people. , The Walter ... the Papua New Guinea Institute of Medical Research (PNGIMR) and ...
... research ?including research involving human embryonic stem cells ?is ... a position statement adopted by the Board of Directors ... the community of scientists on the front lines of ... belief that continued experimentation with human stem cells is ...
Cached Biology News:UIC developing drug for SARS 2UIC developing drug for SARS 3Old drug, new tricks: Prospects for slashing the impact of malaria 2AACR Favors 'full spectrum of stem cell research biology' 2AACR Favors 'full spectrum of stem cell research biology' 3
(Date:8/20/2014)... (PRWEB) August 20, 2014 WriteResult®, a ... today that it has expanded its myPROpad™ ePRO tablet ... EQ-5D-5L, one of the most widely used and ... general health status. The EQ-5D is used during clinical ... a measure that can be used to demonstrate Health-Related ...
(Date:8/19/2014)... 2014 Shimadzu Scientific Instruments has ... and Nexera-i, adding to the company’s extensive line-up ... an intuitive operating environment, and full automation, the ... workflow for conventional to ultra-high-speed analysis. ... intelligent design so users can begin building the ...
(Date:8/19/2014)... 2014 Cellgen Diagnostics ... to fund a corporate lab for its genetic-based ... development is a critical component in the move ... the implementation of personalized medicine – a more ... , Indiegogo contributions will support Cellgen’s intent to ...
(Date:8/19/2014)... August 19, 2014 XenoTech announces ... and cost-effective metabolite production from bioactive small molecules. ... platform, the technology enables convenient and timely assessment ... to XenoTech’s Vice President of Commercial Operations, Christian ... assessing clinical risk can be measured directly by ...
Breaking Biology Technology:EQ-5D™ Assessment Now Available for iPad 2Shimadzu’s New i-Series Integrated Liquid Chromatography Systems Provide Laboratories Wider Range of Analytical Capabilities 2Shimadzu’s New i-Series Integrated Liquid Chromatography Systems Provide Laboratories Wider Range of Analytical Capabilities 3Cellgen Diagnostics Launches Indiegogo Crowdfunding Campaign for DNA Medical Testing Device 2Cellgen Diagnostics Launches Indiegogo Crowdfunding Campaign for DNA Medical Testing Device 3Beyond Metabolite Identification, Testable Quantities Now Offered by XenoTech 2Beyond Metabolite Identification, Testable Quantities Now Offered by XenoTech 3