Navigation Links
Mouse Anti-HD Monoclonal Antibody, Unconjugated, Clone 3D6 from Abnova Corporation

ProductsMouse Anti-HD Monoclonal Antibody, Unconjugated, Clone 3D6 from Abnova Corporation
Company Abnova Corporation
Item Mouse Anti-HD Monoclonal Antibody, Unconjugated, Clone 3D6
Price 
Description Mouse monoclonal antibody raised against a partial recombinant HD.
Immunogen: HD (NP_002102, 81 a.a. ~ 191 a.a) partial recombinant protein with GST tag.
Accession Number: NM_002111
Protein Sequence: AVAEEPLHRPKKELSATKKDRVNHCLTICENIVAQSVRNSPEFQKLLGIAMELFLLCSDDAESDVRMVADECLNKVIKALMDSNLPRLQLELYKEIKKNGAPRSLRAALW*
Info Abnova CorporationAbnova Corporation
Abnova Corporation (HQ)
9th Fl., No. 108, Jhouzih St.
Neihu District, Taipei
114 Taiwan R.O.C.
Tel: +886-2-8751-1888
Fax: +886-2-8751-1166

Abnova GmbH
Boxbergring 107
69126 Heidelberg
Germany
Tel: +49 6221 3632226
Fax: +49 6221 825878

Customer Service: +886-2-8751-1888
Fax Number: +886-2-8751-1166
Web Site: http://www.abnova.com.tw
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Mouse Anti-Amodiaquine Monoclonal Antibody, Unconjugated, Clone 6D10 from AntibodyShop A/S
2. Mouse Anti-Protein S Monoclonal Antibody, Unconjugated, Clone HYB 232-02 from Abcam
3. Mouse Anti-Mouse Glutathione S-transferase M1 (GSTM1) Monoclonal Antibody, Unconjugated from Lifespan Biosciences
4. Mouse Anti-Human S-100 alpha/beta chain Monoclonal Antibody, Unconjugated, Clone 8B10 from Santa Cruz Biotechnology, Inc.
5. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Testis from OriGene Technologies
6. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Brain (adult) from OriGene Technologies
7. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (12.5 - day) from OriGene Technologies
8. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (19 - day) from OriGene Technologies
9. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Thymus from OriGene Technologies
10. Mouse Anti-Human Complement factor B Monoclonal Antibody, Unconjugated, Clone 9B6 from AntibodyShop A/S
11. Mouse Anti-Human Choriongonadotropin (hCG) Monoclonal Antibody, Unconjugated, Clone 5F10 from AntibodyShop A/S
... SpliceArray is a new generation of microarrays ... Service enables you to rapidly elucidate alternatively ... be relevant for drug discovery. The service ... probe design and customized analysis with Agilents ...
... high pressure pump with stepper motor ... drive compensation, reducing pulsing to negligible levels., ... 0.001mL steps. , The pump heads, using ... may be programmed from their keypad, using ...
... variable angle system, 220-240 V, is used to ... DNA fragments by pulsed field gel electrophoresis (PFGE). ... variable-speed pump, 14 x 13 cm casting stand ... mm thick comb, screened cap, disposable plug molds, ...
... membrane and filter paper sandwiches are composed ... two sheets of thick filter paper that ... filter paper sandwich. These 7 x 8.5 ... immunoblotting fit Ready Gel-sized gels and are ...
Biology Products:
(Date:4/28/2016)... 2016 First quarter 2016:   ... with the first quarter of 2015 The gross margin ... (loss: 18.8) and the operating margin was 40% (-13) ... Cash flow from operations was SEK 249.9 M (21.2) , ... unchanged, SEK 7,000-8,500 M. The operating margin for 2016 ...
(Date:4/26/2016)... -- Research and Markets has announced the ...  report to their offering.  , ,     (Logo: ... forecast the global multimodal biometrics market to grow ... 2016-2020.  Multimodal biometrics is being implemented ... healthcare, BFSI, transportation, automotive, and government for controlling ...
(Date:4/15/2016)... April 15, 2016  A new partnership announced ... accurate underwriting decisions in a fraction of the ... priced and high-value life insurance policies to consumers ... With Force Diagnostics, rapid testing (A1C, Cotinine ... readings (blood pressure, weight, pulse, BMI, and activity ...
Breaking Biology News(10 mins):
(Date:5/22/2016)... ... 2016 , ... Doctors in Rome say micronutrients found in certain foods have ... Mesothelioma has just posted an article on the new research. Click here to ... Sciences and Translational Medicine evaluated more than 150 studies on polyphenols in cancer for ...
(Date:5/20/2016)... ... May 20, 2016 , ... Korean researchers say Manumycin A triggers ... a new way to treat the disease. Surviving Mesothelioma has just posted an article ... from several Korean institutions based their mesothelioma study on the fact the Manumycin A, ...
(Date:5/19/2016)... , May 19, 2016  AdvancedFlow Systems ... Inc. (AGI), based out of Maple ... Biogas Ltd. to its existing portfolio of contract ... agreement. AFS along with its sister companies Surround ... a vertically integrated industrial group that specializes in ...
(Date:5/19/2016)... May 19, 2016 ... (OTC PINK: RGBPP) announced today initiation of a ... cord blood based cancer immunotherapeutic product leveraging its ... Regen described a generation of cord blood derived ... gene silencing.  The product in development will be ...
Breaking Biology Technology: