Navigation Links
Mouse Anti-HD Monoclonal Antibody, Unconjugated, Clone 3D6 from Abnova Corporation

ProductsMouse Anti-HD Monoclonal Antibody, Unconjugated, Clone 3D6 from Abnova Corporation
Company Abnova Corporation
Item Mouse Anti-HD Monoclonal Antibody, Unconjugated, Clone 3D6
Price 
Description Mouse monoclonal antibody raised against a partial recombinant HD.
Immunogen: HD (NP_002102, 81 a.a. ~ 191 a.a) partial recombinant protein with GST tag.
Accession Number: NM_002111
Protein Sequence: AVAEEPLHRPKKELSATKKDRVNHCLTICENIVAQSVRNSPEFQKLLGIAMELFLLCSDDAESDVRMVADECLNKVIKALMDSNLPRLQLELYKEIKKNGAPRSLRAALW*
Info Abnova CorporationAbnova Corporation
Abnova Corporation (HQ)
9th Fl., No. 108, Jhouzih St.
Neihu District, Taipei
114 Taiwan R.O.C.
Tel: +886-2-8751-1888
Fax: +886-2-8751-1166

Abnova GmbH
Boxbergring 107
69126 Heidelberg
Germany
Tel: +49 6221 3632226
Fax: +49 6221 825878

Customer Service: +886-2-8751-1888
Fax Number: +886-2-8751-1166
Web Site: http://www.abnova.com.tw
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Mouse Anti-Amodiaquine Monoclonal Antibody, Unconjugated, Clone 6D10 from AntibodyShop A/S
2. Mouse Anti-Protein S Monoclonal Antibody, Unconjugated, Clone HYB 232-02 from Abcam
3. Mouse Anti-Mouse Glutathione S-transferase M1 (GSTM1) Monoclonal Antibody, Unconjugated from Lifespan Biosciences
4. Mouse Anti-Human S-100 alpha/beta chain Monoclonal Antibody, Unconjugated, Clone 8B10 from Santa Cruz Biotechnology, Inc.
5. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Testis from OriGene Technologies
6. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Brain (adult) from OriGene Technologies
7. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (12.5 - day) from OriGene Technologies
8. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (19 - day) from OriGene Technologies
9. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Thymus from OriGene Technologies
10. Mouse Anti-Human Complement factor B Monoclonal Antibody, Unconjugated, Clone 9B6 from AntibodyShop A/S
11. Mouse Anti-Human Choriongonadotropin (hCG) Monoclonal Antibody, Unconjugated, Clone 5F10 from AntibodyShop A/S
SlowFade Antifade Kit with DAPI...
Vitellogenin (Japanese medaka) Standard...
nuclear RNA export factor 1, mRNA...
... (serial analysis of gene expression) ... analysis. Expression profiles generated by ... detect low-abundance transcripts making it ... The I-SAGE Kit is designed ...
Biology Products:
(Date:11/17/2016)... 17, 2016 Global Market Watch: Primarily ... Banks, Population-Based Banks and Academics) market is to witness a ... Biobanks shows the highest Compounded Annual Growth Rate (CAGR) of ... during the analysis period 2014-2020. North America ... followed by Europe at 9.56% respectively. ...
(Date:11/16/2016)... CLARA, Calif. , Nov. 16, 2016 ... enhancing user experience and security for consumer electronics, ... for the financial and retail industry, today announced ... secure and convenient way to authenticate users of ... uses Sensory,s TrulySecure™ software which requires ...
(Date:11/15/2016)... , Nov 15, 2016 Research and ... Global Forecast to 2021" report to their offering. ... ... USD 16.18 Billion by 2021 from USD 6.21 Billion in 2016, ... Growth of the bioinformatics market is driven by the ...
Breaking Biology News(10 mins):
(Date:12/2/2016)... ... ... ACEA Biosciences, Inc. announced today that it will be presenting updated efficacy ... Conference on Lung Cancer 2016, taking place in Vienna, Austria December 3rd-8th. , ... AC0010 in patients with advanced non-small cell lung cancer harboring the EGFR T790M resistance ...
(Date:12/2/2016)... York, NY (PRWEB) , ... December 01, 2016 , ... ... event is expanding to three days and will take place on February 1-3, 2017 ... (GSK) and Dr James Gulley (NCI), the program provides a unique 360-degree approach, which ...
(Date:12/2/2016)... MA (PRWEB) , ... December 02, 2016 , ... Robots ... Light Event on December 3rd, 2016. The event, which is held on the ... work with helping Americans with Disabilities back into the workplace. Suitable Technologies is partnering ...
(Date:11/30/2016)... ... 2016 , ... BEI Kimco, a brand of Sensata Technologies, ... that ensures high alignment accuracy by preventing unwanted shaft rotation. The new VCA ... precision is required, such as in medical equipment, laboratory instrumentation, clean rooms, low-outgassing ...
Breaking Biology Technology: