Navigation Links
Mouse Anti-HD Monoclonal Antibody, Unconjugated, Clone 3D6 from Abnova Corporation

ProductsMouse Anti-HD Monoclonal Antibody, Unconjugated, Clone 3D6 from Abnova Corporation
Company Abnova Corporation
Item Mouse Anti-HD Monoclonal Antibody, Unconjugated, Clone 3D6
Price 
Description Mouse monoclonal antibody raised against a partial recombinant HD.
Immunogen: HD (NP_002102, 81 a.a. ~ 191 a.a) partial recombinant protein with GST tag.
Accession Number: NM_002111
Protein Sequence: AVAEEPLHRPKKELSATKKDRVNHCLTICENIVAQSVRNSPEFQKLLGIAMELFLLCSDDAESDVRMVADECLNKVIKALMDSNLPRLQLELYKEIKKNGAPRSLRAALW*
Info Abnova CorporationAbnova Corporation
Abnova Corporation (HQ)
9th Fl., No. 108, Jhouzih St.
Neihu District, Taipei
114 Taiwan R.O.C.
Tel: +886-2-8751-1888
Fax: +886-2-8751-1166

Abnova GmbH
Boxbergring 107
69126 Heidelberg
Germany
Tel: +49 6221 3632226
Fax: +49 6221 825878

Customer Service: +886-2-8751-1888
Fax Number: +886-2-8751-1166
Web Site: http://www.abnova.com.tw
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Mouse Anti-Amodiaquine Monoclonal Antibody, Unconjugated, Clone 6D10 from AntibodyShop A/S
2. Mouse Anti-Protein S Monoclonal Antibody, Unconjugated, Clone HYB 232-02 from Abcam
3. Mouse Anti-Mouse Glutathione S-transferase M1 (GSTM1) Monoclonal Antibody, Unconjugated from Lifespan Biosciences
4. Mouse Anti-Human S-100 alpha/beta chain Monoclonal Antibody, Unconjugated, Clone 8B10 from Santa Cruz Biotechnology, Inc.
5. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Testis from OriGene Technologies
6. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Brain (adult) from OriGene Technologies
7. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (12.5 - day) from OriGene Technologies
8. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (19 - day) from OriGene Technologies
9. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Thymus from OriGene Technologies
10. Mouse Anti-Human Complement factor B Monoclonal Antibody, Unconjugated, Clone 9B6 from AntibodyShop A/S
11. Mouse Anti-Human Choriongonadotropin (hCG) Monoclonal Antibody, Unconjugated, Clone 5F10 from AntibodyShop A/S
... The mini incubation trays ... used to screen antigens that ... membrane. Each tray has eight ... channels that accommodate strips cut ...
... analysis and experiment control software. Records ... on-line and off-line analysis. powerful stimulus ... language allowing the user to customize ... Applications range from basic data logging ...
... • Small design specifically for western ... ,Trays are specifically designed for staining western ... x 25 mm) of the disposable tray ... a significant cost savings to the user. ...
... a direct antibiotic-based selection ... Recombinant selection depends solely ... the need for costly ... and inexpensive process provides ...
Biology Products:
(Date:7/11/2014)... of kidney injury related to the use of hydroxyethyl ... HES molecules, according to a report in Anesthesia ... Research Society (IARS). , The "total mass of HES ... human renal proximal tubule cells (PTCs), concludes the laboratory ... Hospital Wrzburg, Austria. Other factorssuch as differences in ...
(Date:7/11/2014)... normal circumstances, astrocytes participate in normal physiological ... exhibit therapeutic and repairing effects on brain ... found that nerve cells differentiated from adipose-derived ... viability, which produces influences on subsequent studies ... Hospital, Hebei United University, China demonstrated that ...
(Date:7/11/2014)... to study the proteins that let nerve cells send ... stumbled upon a biological tactic that may offer a ... a safe and environmentally responsible way. , Their ... one species and harmless for a closely related onesuggests ... without harming beneficial species like bees. A summary of ...
Breaking Biology News(10 mins):In lab studies, hydroxyethyl starch has direct harmful effects on kidney cells 2Potent spider toxin 'electrocutes' German, not American, cockroaches 2Potent spider toxin 'electrocutes' German, not American, cockroaches 3
... in the world to have survived exposure to the vacuum ... Ingemar Jnsson, a researcher at Kristianstad University in Sweden. ... Jnsson had some 3,000 microscopic water bears sent up on ... project, which was supported by the European Space Agency, was ...
... September, in the context of France,s presidency of the ... at the Grand Palais. The GMES (Global Monitoring ... to provide services relating to the environment, climate change, ... on data - mainly Earth observation data - from ...
... clear skies and smooth sailing for oceanic vessels has ... to air pollution and greenhouse gas emissions that impact ... James Winebrake and James Corbett examines "Emission Tradeoffs among ... Oil, Marine Gas Oil, and Marine Diesel Oil," in ...
Cached Biology News:Major European program for the environment under the spotlight in Lille, France 2Fuel emissions from marine vessels remain a global concern 2
(Date:7/11/2014)... Fla. , July 11, 2014 /PRNewswire-iReach/ -- Maxim ... high-quality peptides that are used solely in scientific experiments, ... two successful years in business, Maxim Peptide, which was ... just launched a new and updated website that now ... blog section has been updated with fascinating articles about ...
(Date:7/11/2014)... , July 11, 2014 /CNW/ - Sunovion Pharmaceuticals Canada ... TM (eslicarbazepine acetate) for use as a once-daily ... patients with epilepsy who are not satisfactorily controlled with ... use in patients under 18 years of age. ... neurological disorders and according to Epilepsy Canada, it affects ...
(Date:7/10/2014)... UK (PRWEB) July 10, 2014 ... 21st Century Medicine Forum on ‘Commercialising Longevity Research’ ... and entrepreneurs to the London Bioscience Innovation Center ... Research Foundation and Aging Analytics Ltd. The meeting ... investment in translational research for age-related disease, as ...
(Date:7/10/2014)... July 10, 2014 OMICS Group’s 5th ... during 18-20 August, 2014 at Double Tree by Hilton ... recent developments in Analytical & Bioanalytical research methods only ... Speaking on this occasion, Dr. Srinubabu Gedela, MD of ... conference is a remarkable one in bringing a unique ...
Breaking Biology Technology:Maxim Peptide Celebrates Second Anniversary Online with an Updated Website and Special Deals Section 2Sunovion Pharmaceuticals Canada Inc. Announces Health Canada Approval of APTIOM(TM) (eslicarbazepine acetate) as a Once-Daily Adjunctive Treatment for Partial-Onset Seizures in Patients with Epilepsy 2Sunovion Pharmaceuticals Canada Inc. Announces Health Canada Approval of APTIOM(TM) (eslicarbazepine acetate) as a Once-Daily Adjunctive Treatment for Partial-Onset Seizures in Patients with Epilepsy 3Sunovion Pharmaceuticals Canada Inc. Announces Health Canada Approval of APTIOM(TM) (eslicarbazepine acetate) as a Once-Daily Adjunctive Treatment for Partial-Onset Seizures in Patients with Epilepsy 4DKV Sponsors Forum on Commercialising Longevity Research; Brings Together Scientists, Investors, Entrepreneurs and Celebrities 2DKV Sponsors Forum on Commercialising Longevity Research; Brings Together Scientists, Investors, Entrepreneurs and Celebrities 3DKV Sponsors Forum on Commercialising Longevity Research; Brings Together Scientists, Investors, Entrepreneurs and Celebrities 4DKV Sponsors Forum on Commercialising Longevity Research; Brings Together Scientists, Investors, Entrepreneurs and Celebrities 5DKV Sponsors Forum on Commercialising Longevity Research; Brings Together Scientists, Investors, Entrepreneurs and Celebrities 6A Critical Review of Analytical Techniques for Improved Living Standards 2A Critical Review of Analytical Techniques for Improved Living Standards 3A Critical Review of Analytical Techniques for Improved Living Standards 4