Navigation Links
Mouse Anti-HD Monoclonal Antibody, Unconjugated, Clone 3D6 from Abnova Corporation

ProductsMouse Anti-HD Monoclonal Antibody, Unconjugated, Clone 3D6 from Abnova Corporation
Company Abnova Corporation
Item Mouse Anti-HD Monoclonal Antibody, Unconjugated, Clone 3D6
Price 
Description Mouse monoclonal antibody raised against a partial recombinant HD.
Immunogen: HD (NP_002102, 81 a.a. ~ 191 a.a) partial recombinant protein with GST tag.
Accession Number: NM_002111
Protein Sequence: AVAEEPLHRPKKELSATKKDRVNHCLTICENIVAQSVRNSPEFQKLLGIAMELFLLCSDDAESDVRMVADECLNKVIKALMDSNLPRLQLELYKEIKKNGAPRSLRAALW*
Info Abnova CorporationAbnova Corporation
Abnova Corporation (HQ)
9th Fl., No. 108, Jhouzih St.
Neihu District, Taipei
114 Taiwan R.O.C.
Tel: +886-2-8751-1888
Fax: +886-2-8751-1166

Abnova GmbH
Boxbergring 107
69126 Heidelberg
Germany
Tel: +49 6221 3632226
Fax: +49 6221 825878

Customer Service: +886-2-8751-1888
Fax Number: +886-2-8751-1166
Web Site: http://www.abnova.com.tw
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Mouse Anti-Amodiaquine Monoclonal Antibody, Unconjugated, Clone 6D10 from AntibodyShop A/S
2. Mouse Anti-Protein S Monoclonal Antibody, Unconjugated, Clone HYB 232-02 from Abcam
3. Mouse Anti-Mouse Glutathione S-transferase M1 (GSTM1) Monoclonal Antibody, Unconjugated from Lifespan Biosciences
4. Mouse Anti-Human S-100 alpha/beta chain Monoclonal Antibody, Unconjugated, Clone 8B10 from Santa Cruz Biotechnology, Inc.
5. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Testis from OriGene Technologies
6. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Brain (adult) from OriGene Technologies
7. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (12.5 - day) from OriGene Technologies
8. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (19 - day) from OriGene Technologies
9. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Thymus from OriGene Technologies
10. Mouse Anti-Human Complement factor B Monoclonal Antibody, Unconjugated, Clone 9B6 from AntibodyShop A/S
11. Mouse Anti-Human Choriongonadotropin (hCG) Monoclonal Antibody, Unconjugated, Clone 5F10 from AntibodyShop A/S
This STAT antibody sampler pack contains 8 monoclonal ,STAT antibodies....
... Synthetic peptide derived from the C terminal ... This peptide sequence is downstream from ... polyclonal Connexin 36 antibody Cat. No. 51-6300. ... Reactivity: Mouse (positive control: mouse Connexin ...
Kanamycin is used for selection of resistant bacteria. C18H36N4O11xH2SO4. Contains 10 mg/ml kanamycin (base) utilizing kanamycin sulfate in 0.85% saline....
Invitrogen's Calcium Phosphate Transfection Kit provides high-quality reagents to enable the introduction of DNA into tissue culture cells via calcium phosphate co-precipitation....
Biology Products:
(Date:7/31/2014)... NCT00518336) shows the sustained efficacy, immunogenicity and ... vaccine Cervarix. Women vaccinated with the HPV-16/18 ... nine years, and vaccine efficacy (VE) against ... longest follow-up report for a licensed HPV ... full paper. , HPV and vaccination ...
(Date:7/31/2014)... news release is available in German . ... can take up gases similar to a sponge that ... suited for storing hydrogen or greenhouse gases. However, loading ... Karlsruhe Institute of Technology (KIT) now report in ... cor-rosion of the MOF surface. This can be prevented ...
(Date:7/31/2014)... Since Alexandre Edmond Becquerel first discovered the photovoltaic effect ... harness the power of sunlight for its own purposes. ... 2014 issue of the FASEB Journal ... exploiting the power of sunlight by focusing on a ... conserved throughout evolution. This conservationor persistence over time and ...
Breaking Biology News(10 mins):Sustained efficacy, immunogenicity, and safety for GlaxoSmithKline's HPV vaccine 2Sustained efficacy, immunogenicity, and safety for GlaxoSmithKline's HPV vaccine 3Free pores for molecule transport 2Scientists shine bright new light on how living things capture energy from the sun 2
... asthma has been shown to help reduce the formation ... is implicated in the development of Alzheimer,s disease, according ... The researchers published their findings, "Pharmacologic Blockade of 5-Lipoxygenase,Improves ... in the American Journal of Pathology . ...
... The long tendrils of this woody vine, or liana, ... But kudzu may be no match for the lianas of ... studies show that lianas are overgrowing trees in every instance. ... forest ecosystems. Tropical forests contain more than half of ...
... The Pancreatic Cancer Action Network and the American Association ... and E. Scott Seeley, M.D., Ph.D., the 2011 Pancreatic ... each totaling $600,000 over five years, will be formally ... April 2-6. "Because of the poor prognoses and ...
Cached Biology News:Asthma drug could help control or treat Alzheimer's disease 2Stranglers of the tropics -- and beyond 2Stranglers of the tropics -- and beyond 3Pancreatic Cancer Action Network-AACR Pathway to Leadership Grants awarded to early-career investigators 2Pancreatic Cancer Action Network-AACR Pathway to Leadership Grants awarded to early-career investigators 3Pancreatic Cancer Action Network-AACR Pathway to Leadership Grants awarded to early-career investigators 4
(Date:7/31/2014)... 2014 Rancho BioSciences , the ... Omicsoft’s Array Suite with tranSMART . Scientists ... to send data in tranSMART to Array Suite for ... of tranSMART including the new 1.2 release. Array ... storage for the analysis of high dimensional quantification data, ...
(Date:7/31/2014)... Although RNA-Sequencing is a relatively ... analyses appearing around 2008, RNA-Sequencing has rapidly evolved ... In the last several years, assays have improved ... smaller input amounts, process degraded RNA, and perform ... the bioinformatics side, there have been improvements in ...
(Date:7/31/2014)...   BioLife Solutions , Inc. (NASDAQ: ... proprietary clinical grade hypothermic storage and ... products for cells and tissues, today announced today ... be released on Thursday, August 7, 2014, and that ... webcast at 4:30 p.m. ET that afternoon. Management will ...
(Date:7/31/2014)... (PRWEB) July 31, 2014 The Kidney Cancer ... of its monthly news magazine, Kidney Cancer News. , ... presence on a website maintained by an international news organization. ... immediate increase in viewers.” , This month’s program highlights news ... tumors analyzed in a recent study. Kidney Cancer News ...
Breaking Biology Technology:Rancho BioSciences, in Partnership with Omicsoft, have Integrated Array Suite with tranSMART 2Rancho BioSciences, in Partnership with Omicsoft, have Integrated Array Suite with tranSMART 3The Evolution of RNA-Sequencing, Upcoming Live Webinar August 22 hosted by Xtalks 2BioLife Solutions to Report Financial Results for Second Quarter 2014 and Provide Business Update on August 7, 2014 2