Navigation Links
Mouse Anti-HD Monoclonal Antibody, Unconjugated, Clone 3D6 from Abnova Corporation

ProductsMouse Anti-HD Monoclonal Antibody, Unconjugated, Clone 3D6 from Abnova Corporation
Company Abnova Corporation
Item Mouse Anti-HD Monoclonal Antibody, Unconjugated, Clone 3D6
Price 
Description Mouse monoclonal antibody raised against a partial recombinant HD.
Immunogen: HD (NP_002102, 81 a.a. ~ 191 a.a) partial recombinant protein with GST tag.
Accession Number: NM_002111
Protein Sequence: AVAEEPLHRPKKELSATKKDRVNHCLTICENIVAQSVRNSPEFQKLLGIAMELFLLCSDDAESDVRMVADECLNKVIKALMDSNLPRLQLELYKEIKKNGAPRSLRAALW*
Info Abnova CorporationAbnova Corporation
Abnova Corporation (HQ)
9th Fl., No. 108, Jhouzih St.
Neihu District, Taipei
114 Taiwan R.O.C.
Tel: +886-2-8751-1888
Fax: +886-2-8751-1166

Abnova GmbH
Boxbergring 107
69126 Heidelberg
Germany
Tel: +49 6221 3632226
Fax: +49 6221 825878

Customer Service: +886-2-8751-1888
Fax Number: +886-2-8751-1166
Web Site: http://www.abnova.com.tw
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Mouse Anti-Amodiaquine Monoclonal Antibody, Unconjugated, Clone 6D10 from AntibodyShop A/S
2. Mouse Anti-Protein S Monoclonal Antibody, Unconjugated, Clone HYB 232-02 from Abcam
3. Mouse Anti-Mouse Glutathione S-transferase M1 (GSTM1) Monoclonal Antibody, Unconjugated from Lifespan Biosciences
4. Mouse Anti-Human S-100 alpha/beta chain Monoclonal Antibody, Unconjugated, Clone 8B10 from Santa Cruz Biotechnology, Inc.
5. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Testis from OriGene Technologies
6. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Brain (adult) from OriGene Technologies
7. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (12.5 - day) from OriGene Technologies
8. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (19 - day) from OriGene Technologies
9. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Thymus from OriGene Technologies
10. Mouse Anti-Human Complement factor B Monoclonal Antibody, Unconjugated, Clone 9B6 from AntibodyShop A/S
11. Mouse Anti-Human Choriongonadotropin (hCG) Monoclonal Antibody, Unconjugated, Clone 5F10 from AntibodyShop A/S
... Source: E. coli strain containing ... M-MLV Reverse Transcriptase catalyzes the ... or RNA:DNA hybrids(1). Full-length copies of large ... Reverse Transcriptase has a much lower RNase ...
... DNase is a preparation of deoxyribonuclease ... DNA to produce 3-hydroxyl oligonucleotides. This ... applications where maintaining the integrity of ... qualified for use with the Core ...
...
... I, Wild Type Liquid. In 100 ... 200 µM EDTA, 20% glycerol, pH 7.9. AVOID ... is a monomeric protein of 765 amino acids ... relaxation of both positive and negative supercoiled DNAs ...
Biology Products:
(Date:4/13/2016)... , April 13, 2016  IMPOWER physicians supporting ... are setting a new clinical standard in telehealth thanks ... By leveraging the higi platform, IMPOWER patients can routinely ... pulse and body mass index, and, when they opt ... and convenient visit to a local retail location at ...
(Date:3/23/2016)... , March 23, 2016 ... erhöhter Sicherheit Gesichts- und Stimmerkennung mit Passwörtern ... (NASDAQ: MESG ), ein führender ... das Unternehmen mit SpeechPro zusammenarbeitet, um erstmals ... Finanzdienstleistungsbranche, wird die Möglichkeit angeboten, im Rahmen ...
(Date:3/18/2016)... 2016 --> --> ... Manned & Unmanned Vehicles, Physical infrastructure and Perimeter Surveillance & ... the border security market and the continuing migration crisis in ... Europe has led visiongain to publish this unique ... --> defence & security companies in the border ...
Breaking Biology News(10 mins):
(Date:4/27/2016)... ... April 27, 2016 , ... ... Clark has joined the company as an Expert Consultant. Mr. Clark was ... collaborations and managing the development of small molecule monographs based on analytical methods. ...
(Date:4/27/2016)... ... 2016 , ... Global Stem Cells Group CEO Benito Novas announced ... of GSCG affiliate Kimera Labs in Miami. , In 2004, Ross received his Ph.D. ... for hematologic disorders and the suppression of graft vs. host disease (GVHD) under UM ...
(Date:4/27/2016)... , April 27, 2016 ... report with specific focus on US, EU, ... , to the healthcare business intelligence collection ... Complete report on the Flow Cytometry ... and supported with 282 tables and figures is ...
(Date:4/26/2016)... CAMBRIDGE, Mass. (PRWEB) , ... April 26, 2016 , ... ... Herr has been selected as one of three finalists for the European Inventor ... the EPO’s annual innovation prize will be announced at a ceremony in Lisbon on ...
Breaking Biology Technology: