Navigation Links
Mouse Anti-HD Monoclonal Antibody, Unconjugated, Clone 3D6 from Abnova Corporation

ProductsMouse Anti-HD Monoclonal Antibody, Unconjugated, Clone 3D6 from Abnova Corporation
Company Abnova Corporation
Item Mouse Anti-HD Monoclonal Antibody, Unconjugated, Clone 3D6
Price 
Description Mouse monoclonal antibody raised against a partial recombinant HD.
Immunogen: HD (NP_002102, 81 a.a. ~ 191 a.a) partial recombinant protein with GST tag.
Accession Number: NM_002111
Protein Sequence: AVAEEPLHRPKKELSATKKDRVNHCLTICENIVAQSVRNSPEFQKLLGIAMELFLLCSDDAESDVRMVADECLNKVIKALMDSNLPRLQLELYKEIKKNGAPRSLRAALW*
Info Abnova CorporationAbnova Corporation
Abnova Corporation (HQ)
9th Fl., No. 108, Jhouzih St.
Neihu District, Taipei
114 Taiwan R.O.C.
Tel: +886-2-8751-1888
Fax: +886-2-8751-1166

Abnova GmbH
Boxbergring 107
69126 Heidelberg
Germany
Tel: +49 6221 3632226
Fax: +49 6221 825878

Customer Service: +886-2-8751-1888
Fax Number: +886-2-8751-1166
Web Site: http://www.abnova.com.tw
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Mouse Anti-Amodiaquine Monoclonal Antibody, Unconjugated, Clone 6D10 from AntibodyShop A/S
2. Mouse Anti-Protein S Monoclonal Antibody, Unconjugated, Clone HYB 232-02 from Abcam
3. Mouse Anti-Mouse Glutathione S-transferase M1 (GSTM1) Monoclonal Antibody, Unconjugated from Lifespan Biosciences
4. Mouse Anti-Human S-100 alpha/beta chain Monoclonal Antibody, Unconjugated, Clone 8B10 from Santa Cruz Biotechnology, Inc.
5. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Testis from OriGene Technologies
6. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Brain (adult) from OriGene Technologies
7. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (12.5 - day) from OriGene Technologies
8. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (19 - day) from OriGene Technologies
9. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Thymus from OriGene Technologies
10. Mouse Anti-Human Complement factor B Monoclonal Antibody, Unconjugated, Clone 9B6 from AntibodyShop A/S
11. Mouse Anti-Human Choriongonadotropin (hCG) Monoclonal Antibody, Unconjugated, Clone 5F10 from AntibodyShop A/S
Roll of Mesh 5m x 25cm...
Oven mesh sheets, large, 23 x 23cm, pack of 5...
... Phosphatase-2A (PPase-2A) is a serine/threonine phosphatase isolated ... isolated as the heterodimer of 60kDa (A) ... ability to dephosphorylate the a-subunit of phosphorylase ... has broad substrate specificity and may play ...
Immulon 2 HB 1x8 Strip assembled, C-bottom; high binding irradiated surface to provide increased binding affinity for hydrophilic proteins and complexes....
Biology Products:
(Date:3/24/2017)... The Controller General of Immigration from Maldives Mr. ... have received the prestigious international IAIR Award for the most innovative ... ... Maldives Immigration ... Algeen (small picture on the right) have received the IAIR award for ...
(Date:3/22/2017)... VILNIUS, Lithuania , March 21, 2017 /PRNewswire/ ... identification and object recognition technologies, today announced the ... development kit (SDK), which provides improved facial recognition ... safety cameras on a single computer. The new ... algorithms to improve accuracy, and it utilizes a ...
(Date:3/20/2017)... -- PMD Healthcare announces the release of its new ... (WMS), a remote, real-time lung health monitoring and management ... a Medical Device, Digital Health, and Chronic Care Management ... solutions that empower people to improve their healthcare and ... the first ever personal spirometer, Spiro PD, which was ...
Breaking Biology News(10 mins):
(Date:6/15/2017)... ... June 15, 2017 , ... ... (EKG) follows an artist’s journey through creative experimentation and interdisciplinary collaboration. Feature Creep, ... through July 22nd. An opening reception will be held at EKG, located at ...
(Date:6/15/2017)... ... 15, 2017 , ... DuPont Industrial Biosciences (DuPont) announced that ... Bloomberg’s 2017 Sustainable Business Summit: Seattle this Thursday, June 15, at ... a panel titled “Developing a Corporate Renewables Strategy.” , “Consumers want to ...
(Date:6/14/2017)... ... June 14, 2017 , ... Slone Partners welcomed ... steered by the executive search firm, “Building Value in Precision Medicine: Can We ... of Foundation Medicine, led an open discussion with expert panelists Troy Cox, CEO ...
(Date:6/14/2017)... Yonkers, NY (PRWEB) , ... June 14, 2017 ... ... GRAPHALLOY® bushing materials for pumps and process equipment, has appointed Andrew Ondish ... New York. , Ondish holds a B.S. degree in Petroleum Engineering from Colorado ...
Breaking Biology Technology: