Navigation Links
Mouse Anti-FES Polyclonal Antibody, Unconjugated from Abnova Corporation

ProductsMouse Anti-FES Polyclonal Antibody, Unconjugated from Abnova Corporation
Company Abnova Corporation
Item Mouse Anti-FES Polyclonal Antibody, Unconjugated
Price 
Description Mouse polyclonal antibody raised against a partial recombinant FES.
Immunogen: FES (AAH35357, 120 a.a. ~ 250 a.a) partial recombinant protein with GST tag.
Protein Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA
Accession: BC035357
Protein Accession Number: AAH35357
OMIM: 190030,
GeneID: 2242
Lot Number: MM950404136
MA Code: ABVAP62HR
Operation Date: 2006/12/22
Info Abnova CorporationAbnova Corporation
Abnova Corporation (HQ)
9th Fl., No. 108, Jhouzih St.
Neihu District, Taipei
114 Taiwan R.O.C.
Tel: +886-2-8751-1888
Fax: +886-2-8751-1166

Abnova GmbH
Boxbergring 107
69126 Heidelberg
Germany
Tel: +49 6221 3632226
Fax: +49 6221 825878

Customer Service: +886-2-8751-1888
Fax Number: +886-2-8751-1166
Web Site: http://www.abnova.com.tw
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Mouse Anti-Amodiaquine Monoclonal Antibody, Unconjugated, Clone 6D10 from AntibodyShop A/S
2. Mouse Anti-Protein S Monoclonal Antibody, Unconjugated, Clone HYB 232-02 from Abcam
3. Mouse Anti-Mouse Glutathione S-transferase M1 (GSTM1) Monoclonal Antibody, Unconjugated from Lifespan Biosciences
4. Mouse Anti-Human S-100 alpha/beta chain Monoclonal Antibody, Unconjugated, Clone 8B10 from Santa Cruz Biotechnology, Inc.
5. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Testis from OriGene Technologies
6. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Brain (adult) from OriGene Technologies
7. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (12.5 - day) from OriGene Technologies
8. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (19 - day) from OriGene Technologies
9. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Thymus from OriGene Technologies
10. Mouse Anti-Human Complement factor B Monoclonal Antibody, Unconjugated, Clone 9B6 from AntibodyShop A/S
11. Mouse Anti-Human Choriongonadotropin (hCG) Monoclonal Antibody, Unconjugated, Clone 5F10 from AntibodyShop A/S
... DeStreak Reagent, 1 ml. Improves ... gels by preventing streaking.Eliminates extra ... of proteins.Stabilizes proteins throughout entire ... well-resolved protein patterns.Ideal for both ...
LIVE/DEAD® Cell-Mediated Cytotoxicity Kit *for animal cells* *2000 assays*...
SlowFade Antifade Kit with DAPI...
Mouse Collagen IV...
Biology Products:
(Date:2/9/2016)... Aware, Inc. (NASDAQ: AWRE ), a leading supplier ... fourth quarter and year ended December 31, 2015.  ... of 2015 was $6.9 million, an increase of 61% compared to ... the fourth quarter of 2015 was $2.6 million compared to $0.2 ... --> --> Higher revenue and operating income in ...
(Date:2/8/2016)... February 8, 2016 Worldcore ... which presents innovation for clients, comfort and unbeatable ... VoiceKey. --> Worldcore is the ... for clients, comfort and unbeatable security, with a ... Worldcore is the first EU-regulated ...
(Date:2/4/2016)... 2016 The field of Human Microbiome ... most popular hubs of the biotechnology industry. While ... studies of human microbiota, have garnered a lot ... microbiome space has literally exploded in terms of ... report focuses on biomedical aspects of research, development, ...
Breaking Biology News(10 mins):
(Date:2/10/2016)... Springfield, MO (PRWEB) , ... February 10, 2016 ... ... company, will attend the International Society of Pharmaceutical Engineering (ISPE) Rocky Mountain Chapter ... of ISPE is expecting to fill more than 100 tables for its annual ...
(Date:2/10/2016)... ... February 10, 2016 , ... Curoverse ... Azure. On Azure, Arvados provides capabilities for managing and processing genomic and health ... Azure from major institutions collecting and analyzing genomic data,” said Adam Berrey chief ...
(Date:2/9/2016)... ... February 09, 2016 , ... With a presidential election in ... Care Business Conference will bring together over 500 top healthcare leaders for a night ... transformation. The conference, organized by MBA students of the University of Pennsylvania’s Wharton School, ...
(Date:2/9/2016)... ... February 09, 2016 , ... Clinovo , the cloud-based ... Electronic Data Capture (EDC) system ClinCaptureand its new Contract Research Organization (CRO) Partner ... Conference in San Mateo, California on February 10th and 11th. Watch 2-min ...
Breaking Biology Technology: