Navigation Links
Mouse Anti-FES Polyclonal Antibody, Unconjugated from Abnova Corporation

ProductsMouse Anti-FES Polyclonal Antibody, Unconjugated from Abnova Corporation
Company Abnova Corporation
Item Mouse Anti-FES Polyclonal Antibody, Unconjugated
Price 
Description Mouse polyclonal antibody raised against a partial recombinant FES.
Immunogen: FES (AAH35357, 120 a.a. ~ 250 a.a) partial recombinant protein with GST tag.
Protein Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA
Accession: BC035357
Protein Accession Number: AAH35357
OMIM: 190030,
GeneID: 2242
Lot Number: MM950404136
MA Code: ABVAP62HR
Operation Date: 2006/12/22
Info Abnova CorporationAbnova Corporation
Abnova Corporation (HQ)
9th Fl., No. 108, Jhouzih St.
Neihu District, Taipei
114 Taiwan R.O.C.
Tel: +886-2-8751-1888
Fax: +886-2-8751-1166

Abnova GmbH
Boxbergring 107
69126 Heidelberg
Germany
Tel: +49 6221 3632226
Fax: +49 6221 825878

Customer Service: +886-2-8751-1888
Fax Number: +886-2-8751-1166
Web Site: http://www.abnova.com.tw
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Mouse Anti-Amodiaquine Monoclonal Antibody, Unconjugated, Clone 6D10 from AntibodyShop A/S
2. Mouse Anti-Protein S Monoclonal Antibody, Unconjugated, Clone HYB 232-02 from Abcam
3. Mouse Anti-Mouse Glutathione S-transferase M1 (GSTM1) Monoclonal Antibody, Unconjugated from Lifespan Biosciences
4. Mouse Anti-Human S-100 alpha/beta chain Monoclonal Antibody, Unconjugated, Clone 8B10 from Santa Cruz Biotechnology, Inc.
5. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Testis from OriGene Technologies
6. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Brain (adult) from OriGene Technologies
7. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (12.5 - day) from OriGene Technologies
8. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (19 - day) from OriGene Technologies
9. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Thymus from OriGene Technologies
10. Mouse Anti-Human Complement factor B Monoclonal Antibody, Unconjugated, Clone 9B6 from AntibodyShop A/S
11. Mouse Anti-Human Choriongonadotropin (hCG) Monoclonal Antibody, Unconjugated, Clone 5F10 from AntibodyShop A/S
Mouse Anti-20S Proteasome alpha1, 2, 3, 5, 6, & 7-Subunits Monoclonal Antibody, Unconjugated, Clone MCP231 from Calbiochem
Mouse Anti-LATS, large tumor suppressor, homolog 2 (Drosophila) Monoclonal Antibody, Unconjugated, Clone 3D10 from Novus Biologicals
Anti-VAMP-2 (Vesicle-Associated Membrane Protein 2, Synaptobrevin 2) Polyclonal Antibody, Unconjugated from CHEMICON
Human GCP-2, Unconjugated from CHEMICON
Biology Products:
(Date:11/26/2009)...an countries has shown that closing schools in the...e a significant role in reducing illness transmiss...l BMC Infectious Diseases compared opportunities...s, finding that they were reduced when schools are...versity, Belgium, led a team of European researche...
(Date:11/25/2009)...lifornia Institute of Technology (Caltech) have un...ior in the fruit fly, Drosophila melanogaster . ,...lationship between the neurotransmitter dopamine a..., are described in the December issue of the journ...nly about 20,000 neurons and has long been conside...
(Date:11/25/2009)...l Death Research Laboratory in the University of H... prestigious Johnson & Johnson Focused Funding gra...ell damage in Parkinson,s disease. The award, whic... innovation and excellence in science, was announc...month at an event at the Hyatt Regency Hotel in Ne...
Breaking Biology News(10 mins):School closure could reduce swine flu transmission by 21 percent 2Caltech scientists find emotion-like behaviors, regulated by dopamine, in fruit flies 2Caltech scientists find emotion-like behaviors, regulated by dopamine, in fruit flies 3Caltech scientists find emotion-like behaviors, regulated by dopamine, in fruit flies 4Johnson & Johnson award goes to research of the cause of brain cell damage in Parkinson's 2Health Education Solutions Launches Online Certification Programs for Critical Care Medical Professionals 47629 1Health Education Solutions Launches Online Certification Programs for Critical Care Medical Professionals 47629 2Health Education Solutions Launches Online Certification Programs for Critical Care Medical Professionals 47629 3Allscripts and SYNNEX Corporation Form Distribution Partnership to Accelerate Adoption of Electronic Health Records 47626 1Allscripts and SYNNEX Corporation Form Distribution Partnership to Accelerate Adoption of Electronic Health Records 47626 2Allscripts and SYNNEX Corporation Form Distribution Partnership to Accelerate Adoption of Electronic Health Records 47626 3Allscripts and SYNNEX Corporation Form Distribution Partnership to Accelerate Adoption of Electronic Health Records 47626 4Allscripts and SYNNEX Corporation Form Distribution Partnership to Accelerate Adoption of Electronic Health Records 47626 5Diet Purity of Food Source Could be Keys to Improving Health of Hong Kong Toddlers 47623 1Diet Purity of Food Source Could be Keys to Improving Health of Hong Kong Toddlers 47623 2Diet Purity of Food Source Could be Keys to Improving Health of Hong Kong Toddlers 47623 3
...volutionary studies of aging typically utilize sma...er benign conditions constant temperature and hum...boratory. Oddly enough, very little is known about...atural environments. Could it be that these labora...n captive luxury than do their wild cousins?, Nori...
...ts, ability to echolocate may have evolved more th... by Queen Mary, University of London scientists. ,... not all group together in the evolutionary tree o...cating cousins, the fruit bats. This has raised th...lved more than once, or whether the fruit bats som...
...idelberg, 5 September 2008 Even scientists define... surprise that the media also have various ways of... study appearing in the October 2008 issue of EMB... on the analysis of 300 articles in British and No...Daily Mail from the UK; and Aftenposten, Dagbladet...
Other Biology News:Old before their time? Aging in flies under natural vs. laboratory conditions 2Molecular evolution is echoed in bat ears 2What is a gene? 2
(Date:11/24/2009)..., ,Primaryefficacyendpointhasbeenmetforpatie..., , QUEBECCITY,Nov.24/PRNewswire-FirstCall/-A...any"),aglobalbiopharmaceuticalcompanyfocusedonendo...cacydatafromaPhase2studywithitstargetedcytotoxicpe...withadvancedorrecurrentendometrialcancer.Inaperson...
(Date:11/24/2009)...,, REDWOODCITY,Calif.,Nov.24/PRNewswire-Firs...uncedthatRandyScott,GenomicHealth,sExecutiveChairm...eConferenceinNewYorkCityonTuesday,December1,2009at...rchivedwebcastofthepresentation,visittheInvestorRe...vestor.genomichealth.com .Pleaseconnecttothewebsit...
(Date:11/24/2009)...,, SEATTLE,Nov.24/PRNewswire-FirstCall/--Cel...ntwillpresentatthe21stAnnualPiperJaffrayHealthCare...,attheNewYorkPalaceHotel. ,, CTIwillpresentonTu...Floor).AliveaudiowebcastofCTI,spresentationwillbea...beavailableforreplayafterwards. , ,PiperJaffrayHe...
(Date:11/23/2009)..., Graphene consists of a two-dimensional carbon l...exagonal lattice, resembling a honeycomb. Carbon n...ck piles of graphene sheets form graphite. Graphen...extremely tear-resistant, an excellent thermal con...as brittleness and ductility. In addition, graphen...
Breaking Biology Technology:AEterna Zentaris Announces Positive Results for Phase 2 Study with LHRH-Receptor Targeted Cytotoxic Conjugate AEZS-108 in Endometrial Cancer 2AEterna Zentaris Announces Positive Results for Phase 2 Study with LHRH-Receptor Targeted Cytotoxic Conjugate AEZS-108 in Endometrial Cancer 3AEterna Zentaris Announces Positive Results for Phase 2 Study with LHRH-Receptor Targeted Cytotoxic Conjugate AEZS-108 in Endometrial Cancer 4Genomic Health to Present at Piper Jaffray Health Care Conference 2Polymer with honeycomb structure 2