Navigation Links
Mouse Anti-FES Polyclonal Antibody, Unconjugated from Abnova Corporation

ProductsMouse Anti-FES Polyclonal Antibody, Unconjugated from Abnova Corporation
Company Abnova Corporation
Item Mouse Anti-FES Polyclonal Antibody, Unconjugated
Price 
Description Mouse polyclonal antibody raised against a partial recombinant FES.
Immunogen: FES (AAH35357, 120 a.a. ~ 250 a.a) partial recombinant protein with GST tag.
Protein Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA
Accession: BC035357
Protein Accession Number: AAH35357
OMIM: 190030,
GeneID: 2242
Lot Number: MM950404136
MA Code: ABVAP62HR
Operation Date: 2006/12/22
Info Abnova CorporationAbnova Corporation
Abnova Corporation (HQ)
9th Fl., No. 108, Jhouzih St.
Neihu District, Taipei
114 Taiwan R.O.C.
Tel: +886-2-8751-1888
Fax: +886-2-8751-1166

Abnova GmbH
Boxbergring 107
69126 Heidelberg
Germany
Tel: +49 6221 3632226
Fax: +49 6221 825878

Customer Service: +886-2-8751-1888
Fax Number: +886-2-8751-1166
Web Site: http://www.abnova.com.tw
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Mouse Anti-Amodiaquine Monoclonal Antibody, Unconjugated, Clone 6D10 from AntibodyShop A/S
2. Mouse Anti-Protein S Monoclonal Antibody, Unconjugated, Clone HYB 232-02 from Abcam
3. Mouse Anti-Mouse Glutathione S-transferase M1 (GSTM1) Monoclonal Antibody, Unconjugated from Lifespan Biosciences
4. Mouse Anti-Human S-100 alpha/beta chain Monoclonal Antibody, Unconjugated, Clone 8B10 from Santa Cruz Biotechnology, Inc.
5. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Testis from OriGene Technologies
6. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Brain (adult) from OriGene Technologies
7. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (12.5 - day) from OriGene Technologies
8. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (19 - day) from OriGene Technologies
9. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Thymus from OriGene Technologies
10. Mouse Anti-Human Complement factor B Monoclonal Antibody, Unconjugated, Clone 9B6 from AntibodyShop A/S
11. Mouse Anti-Human Choriongonadotropin (hCG) Monoclonal Antibody, Unconjugated, Clone 5F10 from AntibodyShop A/S
Rabbit polyclonal to IRS1 (phospho S636) ( Abpromise for all tested applications). entrezGeneID: 3667 SwissProtID: P35568...
Leucine-rich repeat-containing G-protein coupled receptor 4...
Rabbit polyclonal to MDM2 (phospho S185) ( Abpromise for all tested applications). entrezGeneID: 4193 SwissProtID: Q00987...
ASCIZ...
Biology Products:
(Date:2/28/2017)... 2017 News solutions for biometrics, bag drop ... ... 14 to 16 March, Materna will present its complete end-to-end ... travel is a real benefit for passengers. To accelerate the ... passenger touch point solutions to take passengers through the complete ...
(Date:2/24/2017)... , Feb. 24, 2017  EyeLock LLC, a leader ... its elite iris biometric solution on the latest ... LTE at Mobile World Congress 2017 (February ... Booth in Hall 3, Stand 3E10. ... Qualcomm Haven™ security platform—a combination of hardware, ...
(Date:2/16/2017)... 16, 2017  Genos, a community for personal ... has received Laboratory Accreditation from the College of ... to laboratories that meet stringent requirements around quality, ... processes. "Genos is committed to maintaining ... We,re honored to be receiving CAP accreditation," said ...
Breaking Biology News(10 mins):
(Date:3/22/2017)... ... March 22, 2017 , ... Researchers face a fundamental ... samples to full-size tissues, bones, even whole organs to implant in people to ... blood deep into the developing tissue. , Current bioengineering techniques, including 3-D ...
(Date:3/22/2017)... JERUSALEM , March 22, 2017 ... ( www.oramed.com ), ... of oral drug delivery systems, announced today that ... Officer, will deliver a presentation titled, "Oral Insulin ... upcoming Cambridge Healthtech Institute,s Oligonucleotide and Peptide Therapeutics ...
(Date:3/22/2017)... 22, 2017 /PRNewswire/ - FACIT announced a seed ... "Propellon"), a start-up created by FACIT focused on ... investment, combined with non-dilutive capital, achieves a targeted ... funding enables Propellon to accelerate the nomination of ... financing and/or entering a strategic partnership for clinical ...
(Date:3/22/2017)... ... March 21, 2017 , ... Okyanos Cell Therapy has ... part of their live events series, “Stem Cell Therapy: The Next Phase in the ... the 2013 Stem Cell Research and Therapy Act, Okyanos maintains a mission ...
Breaking Biology Technology: