Navigation Links
Mouse Anti-FES Polyclonal Antibody, Unconjugated from Abnova Corporation

ProductsMouse Anti-FES Polyclonal Antibody, Unconjugated from Abnova Corporation
Company Abnova Corporation
Item Mouse Anti-FES Polyclonal Antibody, Unconjugated
Price 
Description Mouse polyclonal antibody raised against a partial recombinant FES.
Immunogen: FES (AAH35357, 120 a.a. ~ 250 a.a) partial recombinant protein with GST tag.
Protein Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA
Accession: BC035357
Protein Accession Number: AAH35357
OMIM: 190030,
GeneID: 2242
Lot Number: MM950404136
MA Code: ABVAP62HR
Operation Date: 2006/12/22
Info Abnova CorporationAbnova Corporation
Abnova Corporation (HQ)
9th Fl., No. 108, Jhouzih St.
Neihu District, Taipei
114 Taiwan R.O.C.
Tel: +886-2-8751-1888
Fax: +886-2-8751-1166

Abnova GmbH
Boxbergring 107
69126 Heidelberg
Germany
Tel: +49 6221 3632226
Fax: +49 6221 825878

Customer Service: +886-2-8751-1888
Fax Number: +886-2-8751-1166
Web Site: http://www.abnova.com.tw
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Mouse Anti-Amodiaquine Monoclonal Antibody, Unconjugated, Clone 6D10 from AntibodyShop A/S
2. Mouse Anti-Protein S Monoclonal Antibody, Unconjugated, Clone HYB 232-02 from Abcam
3. Mouse Anti-Mouse Glutathione S-transferase M1 (GSTM1) Monoclonal Antibody, Unconjugated from Lifespan Biosciences
4. Mouse Anti-Human S-100 alpha/beta chain Monoclonal Antibody, Unconjugated, Clone 8B10 from Santa Cruz Biotechnology, Inc.
5. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Testis from OriGene Technologies
6. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Brain (adult) from OriGene Technologies
7. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (12.5 - day) from OriGene Technologies
8. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (19 - day) from OriGene Technologies
9. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Thymus from OriGene Technologies
10. Mouse Anti-Human Complement factor B Monoclonal Antibody, Unconjugated, Clone 9B6 from AntibodyShop A/S
11. Mouse Anti-Human Choriongonadotropin (hCG) Monoclonal Antibody, Unconjugated, Clone 5F10 from AntibodyShop A/S
... (KLF15) KLF15 is a Cys2-His2 zinc ... in the liver, kidneys, heart, and skeletal ... Polyclonal antibody produced in rabbits immunized with ... of human KLF15 with an internal ID ...
Caspr2 Antigen: Fusion protein amino acids 96-1265 (extracellular domain) of human Caspr2 Accession Number: NP_054860...
... CELlulose) was developed in the late 1960s ... of the earliest commercial pioneers of immunoassay ... range in 1987. Sac-Cel rapidly found favour ... own "in house" radioimmunoassays, and became a ...
... Accumix standard is a new tuning and ... ionization mass spectrometry. Accumix is a ... range coverage for both tuning and calibration ... LTQ-MS) and Fourier transform mass spectrometers. ...
Biology Products:
(Date:5/16/2017)... 2017  Veratad Technologies, LLC ( www.veratad.com ), an ... identity verification solutions, announced today they will participate as ... 15 thru May 17, 2017, in Washington ... Center. Identity impacts the lives of ... quickly evolving digital world, defining identity is critical to ...
(Date:4/19/2017)... York , April 19, 2017 ... as its vendor landscape is marked by the presence ... market is however held by five major players - ... Together these companies accounted for nearly 61% of the ... the leading companies in the global military biometrics market ...
(Date:4/13/2017)... 2017 According to a new market research report ... Identity Administration, and Authorization), Service, Authentication Type, Deployment Mode, Vertical, and Region ... expected to grow from USD 14.30 Billion in 2017 to USD 31.75 ... ... MarketsandMarkets Logo ...
Breaking Biology News(10 mins):
(Date:5/24/2017)... ... May 24, 2017 , ... ... as treasurer for the Mid-Atlantic chapter of the Healthcare Businesswomen’s Association ... , The HBA Mid-Atlantic chapter board meets in person once each quarter and ...
(Date:5/24/2017)... (PRWEB) , ... May 24, 2017 , ... ... systems are increasingly being developed with Wi-Fi connectivity to reduce the amount of ... room to room. In addition, compact mobile devices including infusion pumps, heart and ...
(Date:5/23/2017)... ... May 23, 2017 , ... ... source of human cardiovascular cells for research and the development of cardiac ... possible to generate large numbers of cardiomyocytes (hPSC-CMs). Due to varying differentiation ...
(Date:5/23/2017)... ... , ... Vortex Biosciences , provider of circulating tumor cell (CTC) capture ... using Vortex microfluidic technology ” in Nature Precision Oncology on May 8th. The ... and Dr. Matthew Rettig at the University of California, Los Angeles. The publication describes ...
Breaking Biology Technology: