Navigation Links
Mouse Anti-FES Polyclonal Antibody, Unconjugated from Abnova Corporation

ProductsMouse Anti-FES Polyclonal Antibody, Unconjugated from Abnova Corporation
Company Abnova Corporation
Item Mouse Anti-FES Polyclonal Antibody, Unconjugated
Price 
Description Mouse polyclonal antibody raised against a partial recombinant FES.
Immunogen: FES (AAH35357, 120 a.a. ~ 250 a.a) partial recombinant protein with GST tag.
Protein Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA
Accession: BC035357
Protein Accession Number: AAH35357
OMIM: 190030,
GeneID: 2242
Lot Number: MM950404136
MA Code: ABVAP62HR
Operation Date: 2006/12/22
Info Abnova CorporationAbnova Corporation
Abnova Corporation (HQ)
9th Fl., No. 108, Jhouzih St.
Neihu District, Taipei
114 Taiwan R.O.C.
Tel: +886-2-8751-1888
Fax: +886-2-8751-1166

Abnova GmbH
Boxbergring 107
69126 Heidelberg
Germany
Tel: +49 6221 3632226
Fax: +49 6221 825878

Customer Service: +886-2-8751-1888
Fax Number: +886-2-8751-1166
Web Site: http://www.abnova.com.tw
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Mouse Anti-Amodiaquine Monoclonal Antibody, Unconjugated, Clone 6D10 from AntibodyShop A/S
2. Mouse Anti-Protein S Monoclonal Antibody, Unconjugated, Clone HYB 232-02 from Abcam
3. Mouse Anti-Mouse Glutathione S-transferase M1 (GSTM1) Monoclonal Antibody, Unconjugated from Lifespan Biosciences
4. Mouse Anti-Human S-100 alpha/beta chain Monoclonal Antibody, Unconjugated, Clone 8B10 from Santa Cruz Biotechnology, Inc.
5. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Testis from OriGene Technologies
6. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Brain (adult) from OriGene Technologies
7. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (12.5 - day) from OriGene Technologies
8. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (19 - day) from OriGene Technologies
9. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Thymus from OriGene Technologies
10. Mouse Anti-Human Complement factor B Monoclonal Antibody, Unconjugated, Clone 9B6 from AntibodyShop A/S
11. Mouse Anti-Human Choriongonadotropin (hCG) Monoclonal Antibody, Unconjugated, Clone 5F10 from AntibodyShop A/S
Umbilical cord blood mesenchymal stem cells, For immunohistochemistry (IHC) Cell Chip with Human Umbilical Cord Blood Progenitor Cells...
Cord blood endothelial progenitor cells, For immunohistochemistry (IHC) Cell Chip with Human Umbilical Cord Blood Progenitor Cells...
Human peripheral blood basophils, For immunohistochemistry (IHC) Cell Chip with Human Peripheral Blood Granulocytes...
Human peripheral blood neutrophils, For immunohistochemistry (IHC) Cell Chip with Human Peripheral Blood Granulocytes...
Biology Products:
(Date:11/29/2016)... Lithuania , Nov. 29, 2016 /PRNewswire/ ... biometric identification and object recognition technologies, today ... (SDK) for fingerprint recognition solutions that run ... a fingerprint template using less than 128KB ... in compact devices that have limited on-board ...
(Date:11/22/2016)... India , November 22, 2016 According to ... (Fingerprint, IRIS, Palm Print, Face, Vein, Signature, Voice), Multi-Factor), Component (Hardware and ... 2022", published by MarketsandMarkets, the market is expected to grow from USD ... a CAGR of 16.79% between 2016 and 2022. ... ...
(Date:11/17/2016)... , Nov. 17, 2016 Global Market Watch: ... Public Biobanks (Disease-Based Banks, Population-Based Banks and Academics) market is ... analysis for Private Biobanks shows the highest Compounded Annual Growth ... region during the analysis period 2014-2020. ... CAGR of 9.95% followed by Europe ...
Breaking Biology News(10 mins):
(Date:12/2/2016)... ... December 01, 2016 , ... Orthogonal, ... on their recent FDA Class II 510(k) clearance for their flagship medical device, ... commercializing remote cardiac monitoring devices that rely on cloth-based nanosensors. While other companies ...
(Date:12/2/2016)... 2016 The immunohistochemistry (IHC) market is ... CAGR of 7.3% during the forecast period of 2016 to 2021 ... segment accounted for the largest share of immunohistochemistry (IHC) market, by ... , , ... (IHC) market spread across 225 pages, profiling 10 companies and supported ...
(Date:11/30/2016)... New York , November 30, 2016 ... consolidated as a few players hold a dominant share ... Group, Charles River Laboratories International, Inc., and Merck KGaA, ... market in 2015. Transparency Market Research observes that these ... are focused on development products that are do not ...
(Date:11/30/2016)... Nov. 30, 2016 /PRNewswire/ -  Equicare Health Inc ., ... been recognized as one of the top 100 companies ... international listing that distinguishes the top digital health companies ... great step forward this year continually upgrading our product ... customer base and team," says Len Grenier , ...
Breaking Biology Technology: