Navigation Links
Mouse Anti-FES Polyclonal Antibody, Unconjugated from Abnova Corporation

ProductsMouse Anti-FES Polyclonal Antibody, Unconjugated from Abnova Corporation
Company Abnova Corporation
Item Mouse Anti-FES Polyclonal Antibody, Unconjugated
Price 
Description Mouse polyclonal antibody raised against a partial recombinant FES.
Immunogen: FES (AAH35357, 120 a.a. ~ 250 a.a) partial recombinant protein with GST tag.
Protein Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA
Accession: BC035357
Protein Accession Number: AAH35357
OMIM: 190030,
GeneID: 2242
Lot Number: MM950404136
MA Code: ABVAP62HR
Operation Date: 2006/12/22
Info Abnova CorporationAbnova Corporation
Abnova Corporation (HQ)
9th Fl., No. 108, Jhouzih St.
Neihu District, Taipei
114 Taiwan R.O.C.
Tel: +886-2-8751-1888
Fax: +886-2-8751-1166

Abnova GmbH
Boxbergring 107
69126 Heidelberg
Germany
Tel: +49 6221 3632226
Fax: +49 6221 825878

Customer Service: +886-2-8751-1888
Fax Number: +886-2-8751-1166
Web Site: http://www.abnova.com.tw
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Mouse Anti-Amodiaquine Monoclonal Antibody, Unconjugated, Clone 6D10 from AntibodyShop A/S
2. Mouse Anti-Protein S Monoclonal Antibody, Unconjugated, Clone HYB 232-02 from Abcam
3. Mouse Anti-Mouse Glutathione S-transferase M1 (GSTM1) Monoclonal Antibody, Unconjugated from Lifespan Biosciences
4. Mouse Anti-Human S-100 alpha/beta chain Monoclonal Antibody, Unconjugated, Clone 8B10 from Santa Cruz Biotechnology, Inc.
5. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Testis from OriGene Technologies
6. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Brain (adult) from OriGene Technologies
7. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (12.5 - day) from OriGene Technologies
8. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (19 - day) from OriGene Technologies
9. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Thymus from OriGene Technologies
10. Mouse Anti-Human Complement factor B Monoclonal Antibody, Unconjugated, Clone 9B6 from AntibodyShop A/S
11. Mouse Anti-Human Choriongonadotropin (hCG) Monoclonal Antibody, Unconjugated, Clone 5F10 from AntibodyShop A/S
... M-840 HEXALIGHT robot is based on PI's ... over more than a decade. PI Hexapods ... mirror and antenna adjustments over wide ranges ... six degrees of freedom with 3 m ...
... the experimental process of determining the nucleotide ... DNA Sequencing is based on Sangers enzymatic ... allows cycle sequencing reactions. The resulting fluorescent ... capillary instrument controlled by a computer and ...
...
High-throughput DNA sequencing of any library. Just give us your transformation mixture, and we'll do the rest. ABI 3730xl's yield the longest read lengths available. LIMS tracking utilizing Geospiza...
Biology Products:
(Date:1/6/2017)... JOLLA, Calif. , Jan. 6, 2017 /PRNewswire/ ... 1 safety studies in healthy volunteers of a ... intended to treat acute pancreatitis. ... is typically a mild disorder, but can be ... organ failure and sepsis, where extended hospital stays, ...
(Date:1/3/2017)... 2017 Onitor, provider of digital health technology ... an innovative biometric data-driven program designed to aid weight ... the 2017 Consumer Electronics Show (CES) in ... U.S., the World Health Organization (WHO), have identified lifestyle ... who are overweight or obese. WHO also states that ...
(Date:12/19/2016)... , 19 de diciembre de 2016  Mosaic Biomedicals SL anunció ... acelerado de MSC-1, un anticuerpo humanizado que se espera comenzar a ... con múltiples sitios previstos a lo largo de Europa y Norteamérica. ... MSC-1 es el ... de leucemia (LIF), una citoquina pleiotrópica que se sobreexpresa en ciertos ...
Breaking Biology News(10 mins):
(Date:1/18/2017)... 18, 2017   Boston Biomedical , an industry ... target cancer stemness pathways, will feature data from two ... the 2017 ASCO Gastrointestinal Cancers Symposium, held from January ... Napabucasin is an orally-administered investigational agent designed ... Cancer stem cells (CSCs) possess the property of ...
(Date:1/18/2017)... ... 2017 , ... Whitehouse Labs has furthered its efforts towards ... (AMRI), the scientific staff dedicated to Extractables / Leachables & Impurities has more ... 2017. Extractable & Leachable evaluations have become increasingly more vital to successful product ...
(Date:1/18/2017)... ... January 18, 2017 , ... BidMed, LLC, ... research and genetic testing lab equipment from two different leading institutes. This highly specialized ... regions of the United States. This 1-day online auction will take place on ...
(Date:1/18/2017)... Jan. 18, 2017  Caris Life Sciences, a ... Foundation, the largest private funder of pancreatic cancer ... evaluating the impact of immunotherapy in the treatment ... enrollment services to identify potential trial candidates based ... treating physicians and study investigators. The Lustgarten Foundation ...
Breaking Biology Technology: