Navigation Links
Mouse Anti-FES Polyclonal Antibody, Unconjugated from Abnova Corporation

ProductsMouse Anti-FES Polyclonal Antibody, Unconjugated from Abnova Corporation
Company Abnova Corporation
Item Mouse Anti-FES Polyclonal Antibody, Unconjugated
Price 
Description Mouse polyclonal antibody raised against a partial recombinant FES.
Immunogen: FES (AAH35357, 120 a.a. ~ 250 a.a) partial recombinant protein with GST tag.
Protein Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA
Accession: BC035357
Protein Accession Number: AAH35357
OMIM: 190030,
GeneID: 2242
Lot Number: MM950404136
MA Code: ABVAP62HR
Operation Date: 2006/12/22
Info Abnova CorporationAbnova Corporation
Abnova Corporation (HQ)
9th Fl., No. 108, Jhouzih St.
Neihu District, Taipei
114 Taiwan R.O.C.
Tel: +886-2-8751-1888
Fax: +886-2-8751-1166

Abnova GmbH
Boxbergring 107
69126 Heidelberg
Germany
Tel: +49 6221 3632226
Fax: +49 6221 825878

Customer Service: +886-2-8751-1888
Fax Number: +886-2-8751-1166
Web Site: http://www.abnova.com.tw
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Mouse Anti-Amodiaquine Monoclonal Antibody, Unconjugated, Clone 6D10 from AntibodyShop A/S
2. Mouse Anti-Protein S Monoclonal Antibody, Unconjugated, Clone HYB 232-02 from Abcam
3. Mouse Anti-Mouse Glutathione S-transferase M1 (GSTM1) Monoclonal Antibody, Unconjugated from Lifespan Biosciences
4. Mouse Anti-Human S-100 alpha/beta chain Monoclonal Antibody, Unconjugated, Clone 8B10 from Santa Cruz Biotechnology, Inc.
5. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Testis from OriGene Technologies
6. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Brain (adult) from OriGene Technologies
7. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (12.5 - day) from OriGene Technologies
8. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (19 - day) from OriGene Technologies
9. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Thymus from OriGene Technologies
10. Mouse Anti-Human Complement factor B Monoclonal Antibody, Unconjugated, Clone 9B6 from AntibodyShop A/S
11. Mouse Anti-Human Choriongonadotropin (hCG) Monoclonal Antibody, Unconjugated, Clone 5F10 from AntibodyShop A/S
... Choice Microsphere/Microarray Stabilizer is a is a ... This product is an aqueous solution ... buffer (phosphate buffered saline), pH 6.6 - ... of 0.02% methylisothiazolone and 0.02% bromonitrodioxane as ...
... F1 antigen, Monoclonal Antibody, Unconjugated ... Use at an assay dependent dilution. ... dilution. WB: Use at an assay ... kDa. Not tested in other applications. ...
... formulated for mounting tissue specimens, cell smears, ... immunohistochemical methods for viewing by light microscopy. ... such as AEC, that are alcohol-soluble or ... when slides are cover-slipped forming a coating ...
... is formulated for covering tissue sections and cell preparations immunohistochemically ... products. , ... Application: Vision ... AEC that require an aqueous mounting medium, or those that ...
Biology Products:
(Date:6/25/2015)... June 25, 2015  Imagine a tool specifically designed ... healthier, happier life. That,s exactly what USANA,s True ... The cutting-edge, portable health program provides a personalized approached ... help improve your lifestyle and nutrition. ... gala Wednesday night, USANA,s THA was honored with the ...
(Date:6/24/2015)... This report provides market analysis of the ... It contains an analysis of the drivers, challenges, and ... from the short, medium, and long term perspective landscapes. ... and technology trends that currently, prevail in the market. ... to efficiently manage the increasing marine traffic and increasing ...
(Date:6/24/2015)... Switzerland , June 24, 2015 ... partnership with emerging biometric password solution one face ... one face in, entering ... a ground-breaking and affordable multifactor-authentication biometric answer to ... recognition technology, provided in partnership with KeyLemon, one ...
Breaking Biology News(10 mins):@USANAinc's Personalized Nutrition Program Wins Industry Innovation Award 2Automatic Identification System Market by Class, by Platform, by Application and by Geography - Global Forecasts & Analysis to 2014 - 2020 2KeyLemon Announces Partnership With Biometric Password Solution onefacein 2
... Tactical,Products Inc. (Pink Sheets: PDGT.PK), a leading provider ... military as well as to,the corrections, law enforcement ... the company the largest distributor of a unique ... detector models in,the United States. In addition an ...
... Ghent, Belgium VIB researchers at Ghent University have ... offshoots in plants, and how it works. Root offshoots ... Plants draw the necessary nutrients from the soil through ... well-branched root system, plants must form offshoots of their ...
... YORK, Oct. 23, 2008 -- Hypnosis can induce "synesthetic" ... of another within an average brain, according to ... the premiere publication of the Association for Psychological ... synesthesia, contrary to popular belief, do not necessarily have ...
Cached Biology News:Paradigm Tactical Products to be Largest Distributor of Metal/Radiation Detection Wands in United States 2Paradigm Tactical Products to be Largest Distributor of Metal/Radiation Detection Wands in United States 3Origin of root offshoots revealed 2Origin of root offshoots revealed 3Ben-Gurion University of the Negev researchers help find that hypnosis can induce synesthesia 2
(Date:7/29/2015)... 2015  HealthSouth Corporation (NYSE: HLS ... post-acute healthcare services, offering both facility-based and home-based ... for the second quarter ended June 30, 2015. ... strong volume growth in both segments and an ... Grinney, President and Chief Executive Officer of HealthSouth. ...
(Date:7/29/2015)... ... July 29, 2015 , ... G-CON Manufacturing, Inc., the ... their 2nd generation cell therapy POD® design. The 2nd generation portfolio not only ... a new POD® design. , “G-CON first offered our miniPOD CT product ...
(Date:7/29/2015)... (PRWEB) , ... July 29, 2015 , ... ... solutions, today announced its GHS Label Guide . To align chemical container ... (GHS), this guide includes explanations of label components, an example of an accurate ...
(Date:7/29/2015)... 29, 2015  Therapath Neuropathology ( www.Therapath.com ), ... with VA and Military Medical centers both domestically ... (ENFD) and Sweat Gland Nerve Fiber Density (SGNFD) ... https://therapath.com/skin ). Demonstration of a ... on punch skin biopsy is a highly sensitive ...
Breaking Biology Technology:HealthSouth Reports Results for Second Quarter 2015 2HealthSouth Reports Results for Second Quarter 2015 3HealthSouth Reports Results for Second Quarter 2015 4HealthSouth Reports Results for Second Quarter 2015 5HealthSouth Reports Results for Second Quarter 2015 6HealthSouth Reports Results for Second Quarter 2015 7HealthSouth Reports Results for Second Quarter 2015 8HealthSouth Reports Results for Second Quarter 2015 9HealthSouth Reports Results for Second Quarter 2015 10HealthSouth Reports Results for Second Quarter 2015 11HealthSouth Reports Results for Second Quarter 2015 12HealthSouth Reports Results for Second Quarter 2015 13HealthSouth Reports Results for Second Quarter 2015 14HealthSouth Reports Results for Second Quarter 2015 15HealthSouth Reports Results for Second Quarter 2015 16HealthSouth Reports Results for Second Quarter 2015 17HealthSouth Reports Results for Second Quarter 2015 18HealthSouth Reports Results for Second Quarter 2015 19HealthSouth Reports Results for Second Quarter 2015 20HealthSouth Reports Results for Second Quarter 2015 21HealthSouth Reports Results for Second Quarter 2015 22HealthSouth Reports Results for Second Quarter 2015 23HealthSouth Reports Results for Second Quarter 2015 24HealthSouth Reports Results for Second Quarter 2015 25HealthSouth Reports Results for Second Quarter 2015 26HealthSouth Reports Results for Second Quarter 2015 27HealthSouth Reports Results for Second Quarter 2015 28HealthSouth Reports Results for Second Quarter 2015 29HealthSouth Reports Results for Second Quarter 2015 30HealthSouth Reports Results for Second Quarter 2015 31HealthSouth Reports Results for Second Quarter 2015 32HealthSouth Reports Results for Second Quarter 2015 33HealthSouth Reports Results for Second Quarter 2015 34HealthSouth Reports Results for Second Quarter 2015 35HealthSouth Reports Results for Second Quarter 2015 36