Navigation Links
Mouse Anti-FES Polyclonal Antibody, Unconjugated from Abnova Corporation

ProductsMouse Anti-FES Polyclonal Antibody, Unconjugated from Abnova Corporation
Company Abnova Corporation
Item Mouse Anti-FES Polyclonal Antibody, Unconjugated
Price 
Description Mouse polyclonal antibody raised against a partial recombinant FES.
Immunogen: FES (AAH35357, 120 a.a. ~ 250 a.a) partial recombinant protein with GST tag.
Protein Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA
Accession: BC035357
Protein Accession Number: AAH35357
OMIM: 190030,
GeneID: 2242
Lot Number: MM950404136
MA Code: ABVAP62HR
Operation Date: 2006/12/22
Info Abnova CorporationAbnova Corporation
Abnova Corporation (HQ)
9th Fl., No. 108, Jhouzih St.
Neihu District, Taipei
114 Taiwan R.O.C.
Tel: +886-2-8751-1888
Fax: +886-2-8751-1166

Abnova GmbH
Boxbergring 107
69126 Heidelberg
Germany
Tel: +49 6221 3632226
Fax: +49 6221 825878

Customer Service: +886-2-8751-1888
Fax Number: +886-2-8751-1166
Web Site: http://www.abnova.com.tw
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Mouse Anti-Amodiaquine Monoclonal Antibody, Unconjugated, Clone 6D10 from AntibodyShop A/S
2. Mouse Anti-Protein S Monoclonal Antibody, Unconjugated, Clone HYB 232-02 from Abcam
3. Mouse Anti-Mouse Glutathione S-transferase M1 (GSTM1) Monoclonal Antibody, Unconjugated from Lifespan Biosciences
4. Mouse Anti-Human S-100 alpha/beta chain Monoclonal Antibody, Unconjugated, Clone 8B10 from Santa Cruz Biotechnology, Inc.
5. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Testis from OriGene Technologies
6. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Brain (adult) from OriGene Technologies
7. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (12.5 - day) from OriGene Technologies
8. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (19 - day) from OriGene Technologies
9. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Thymus from OriGene Technologies
10. Mouse Anti-Human Complement factor B Monoclonal Antibody, Unconjugated, Clone 9B6 from AntibodyShop A/S
11. Mouse Anti-Human Choriongonadotropin (hCG) Monoclonal Antibody, Unconjugated, Clone 5F10 from AntibodyShop A/S
Request Info...
Rabbit polyclonal to UBC12 (rating: ****) ( Abpromise for all tested applications). Antigen: Synthetic peptide: RGGYIGSTYFER, corresponding to amino acids 169-180 of UBC12 Entrez Gene ID: 90...
Applications: Beadlyte® assay Stability: 2 years at 4°C (lyophilized) or 6 months at -20°C (rehydrated) ...
... Sequencing Quality 96 Well BAC ... template preparation from 1.5ml 2xYT ... for automated fluorescent sequencing for ... Utilizes ProPrep strategy which minimizes ...
Biology Products:
(Date:3/22/2017)... NEW YORK , March 21, 2017 /PRNewswire/ ... Customer Marketing Cloud used by retailers such as ... in its platform — Product Recommendations and Replenishment. Using ... to give more personalized product and replenishment recommendations ... purchases, but also on predictions of customer intent ...
(Date:3/16/2017)... CeBIT 2017 - Against identity fraud with DERMALOG solutions "Made in ... ... combined in one project, multi-biometric solutions provide a crucial contribution against identity fraud. (PRNewsFoto/Dermalog Identification ... Used combined in one project, multi-biometric solutions provide a ... ...
(Date:3/7/2017)... , March 7, 2017 Brandwatch , the ... by The Prince,s Trust to uncover insights to support ... The Trust. The UK,s leading youth charity will be ... campaign results and get a better understanding of the topics and ... ...
Breaking Biology News(10 mins):
(Date:4/20/2017)... Lilly and Company (NYSE: LLY ) will ... of migraine at the American Academy of Neurology (AAN) ... in Boston . ... and patient outcomes data for galcanezumab in patients with ... migraine headache days among patients with episodic migraine. Lilly ...
(Date:4/20/2017)... Life Sciences Inc. (TSX: PLI) (OTCQX: PFSCF) ("Prometic" or the ... ("ILC") 2017 of the European Association for the Study of ... the positive effects of PBI-4050 on reduction of non-alcoholic steatohepatitis ... ... Gagnon, Vice-President of R&D Pre-clinical of Prometic "This extensive preclinical ...
(Date:4/20/2017)... philosopher Koert van Mensvoort - founder of the Next Nature Network ... - has written a ,Letter to Humanity, in support of International ... slave and victim to its own technology, but to employ technology to enhance ... ... founder of the Next Nature Network and Fellow of ‘Next Nature’ at the ...
(Date:4/19/2017)... ... 18, 2017 , ... A number of new instruments have recently emerged to ... the Protein and Cell Analysis Education Webinar Series , will focus on advances ... current and future applications. , Many flow cytometers have unique capabilities and the ...
Breaking Biology Technology: