Navigation Links
Mouse Anti-FES Polyclonal Antibody, Unconjugated from Abnova Corporation

ProductsMouse Anti-FES Polyclonal Antibody, Unconjugated from Abnova Corporation
Company Abnova Corporation
Item Mouse Anti-FES Polyclonal Antibody, Unconjugated
Price 
Description Mouse polyclonal antibody raised against a partial recombinant FES.
Immunogen: FES (AAH35357, 120 a.a. ~ 250 a.a) partial recombinant protein with GST tag.
Protein Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA
Accession: BC035357
Protein Accession Number: AAH35357
OMIM: 190030,
GeneID: 2242
Lot Number: MM950404136
MA Code: ABVAP62HR
Operation Date: 2006/12/22
Info Abnova CorporationAbnova Corporation
Abnova Corporation (HQ)
9th Fl., No. 108, Jhouzih St.
Neihu District, Taipei
114 Taiwan R.O.C.
Tel: +886-2-8751-1888
Fax: +886-2-8751-1166

Abnova GmbH
Boxbergring 107
69126 Heidelberg
Germany
Tel: +49 6221 3632226
Fax: +49 6221 825878

Customer Service: +886-2-8751-1888
Fax Number: +886-2-8751-1166
Web Site: http://www.abnova.com.tw
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Mouse Anti-Amodiaquine Monoclonal Antibody, Unconjugated, Clone 6D10 from AntibodyShop A/S
2. Mouse Anti-Protein S Monoclonal Antibody, Unconjugated, Clone HYB 232-02 from Abcam
3. Mouse Anti-Mouse Glutathione S-transferase M1 (GSTM1) Monoclonal Antibody, Unconjugated from Lifespan Biosciences
4. Mouse Anti-Human S-100 alpha/beta chain Monoclonal Antibody, Unconjugated, Clone 8B10 from Santa Cruz Biotechnology, Inc.
5. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Testis from OriGene Technologies
6. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Brain (adult) from OriGene Technologies
7. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (12.5 - day) from OriGene Technologies
8. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (19 - day) from OriGene Technologies
9. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Thymus from OriGene Technologies
10. Mouse Anti-Human Complement factor B Monoclonal Antibody, Unconjugated, Clone 9B6 from AntibodyShop A/S
11. Mouse Anti-Human Choriongonadotropin (hCG) Monoclonal Antibody, Unconjugated, Clone 5F10 from AntibodyShop A/S
(Date:12/17/2014)... , Dec. 16, 2014  Automation is ... this more evident than at international borders. Over ... document scanners have allowed veteran travelers to self ... Passport Control (APC) Kiosks at an increasing number ... globe. According to Maxine ...
(Date:12/11/2014)... Dec. 10, 2014  Data Sciences International (DSI), ... released a new series of digital telemetry implants ... researchers. M series, part of the PhysioTel™ Digital ... best possible physiologic data when incorporating functional endpoints ... endpoints to toxicology studies has evolved from short ...
(Date:12/10/2014)... 2014 Research and Markets ( ... "Biometrics Market in Japan 2014-2018" report ... http://photos.prnewswire.com/prnh/20130307/600769 The integration of biometrics ... banking and upgradation of the driver,s license is ... market. Besides the aforementioned projects, biometrics is being ...
Breaking Biology News(10 mins):Automated Border Control (ABC) Transforms the Global Travel Experience With More Than 2500 ABC eGates and APC Kiosks Deployed In Airports, Seaports, and Land Borders Worldwide 2New telemetry implants expected to change how large animal toxicology studies are conducted 2Biometrics Market in Japan 2014-2018: Key Vendors are DDS, Fujitsu, Hitachi and NEC 2
... The Yam bean originated where the Andes meet the Amazon ... Asia, East Asia and the Pacific. It is produced in ... Interbreeding of the bean has resulted in fertile and stable ... single species, provide high quality food production and offer a ...
... Agricultural Biotechnology: Economics and Policy, edited by ... Zilberman, has won the Quality of Communication Award ... Award recognizes publications that demonstrate superior communication of ... Regulating Agricultural Biotechnology: Economics and Policy assembles ...
... named as the 2007 winner of the ALPSP/Charlesworth Award ... recognises a significantly innovative approach to any aspect of ... this years award was RSC Project Prospect from the ... of semantics into chemical science publishing. RSC Project Prospect ...
Cached Biology News:Yam bean a nearly forgotten crop 2RSC Project Prospect scoops prestigious award 2
(Date:12/17/2014)... 2014 Achim Noack has been named ... Group. In this position, Noack will assist Jerry Stoller, ... develop marketing strategy and supervise global marketing management and ... has tremendous knowledge and experience in the crop protection ... experience and innovative thinking will be a great asset ...
(Date:12/17/2014)... Park, CA (PRWEB) December 17, 2014 ... announces today that it has entered into a ... Midland Company (ADM) to apply DNA2.0’s proprietary protein ... enzyme engineering process. , “We are extremely excited ... ProteinGPS engineering platform. This proprietary bioengineering technology ...
(Date:12/17/2014)... , Dec. 17, 2014 Tigercat Pharma, ... 2 study evaluating the investigational oral NK-1 receptor ... with severe, chronic itch who are unresponsive or ... including topical steroids and antihistamines. ... Visual Analog Scale (VAS) itch score from baseline, ...
(Date:12/15/2014)... NEW YORK , Dec. 15, 2014  GlassesOff ... Yuval Bar-Gil as an independent director of ... was founder of AeroScout and served as its CEO ... Decker in 2012, a $240 million transaction. Recognized as ... under Mr. Bar-Gil,s leadership, AeroScout provided Wi-Fi -based RFID ...
Breaking Biology Technology:Achim Noack Joins Stoller Group as Global Vice President of Marketing and Administration 2ADM and DNA2.0 Enter Into Protein Engineering Technology Access and Service Agreement 2Velocity Pharmaceutical Development, LLC and Tigercat Pharma, Inc. Announce Phase 2 Results for VPD-737 in Patients With Chronic Pruritus 2Velocity Pharmaceutical Development, LLC and Tigercat Pharma, Inc. Announce Phase 2 Results for VPD-737 in Patients With Chronic Pruritus 3Velocity Pharmaceutical Development, LLC and Tigercat Pharma, Inc. Announce Phase 2 Results for VPD-737 in Patients With Chronic Pruritus 4AeroScout Founder Joins GlassesOff's Board of Directors 2AeroScout Founder Joins GlassesOff's Board of Directors 3