Navigation Links
Mouse Anti-FES Polyclonal Antibody, Unconjugated from Abnova Corporation

ProductsMouse Anti-FES Polyclonal Antibody, Unconjugated from Abnova Corporation
Company Abnova Corporation
Item Mouse Anti-FES Polyclonal Antibody, Unconjugated
Price 
Description Mouse polyclonal antibody raised against a partial recombinant FES.
Immunogen: FES (AAH35357, 120 a.a. ~ 250 a.a) partial recombinant protein with GST tag.
Protein Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA
Accession: BC035357
Protein Accession Number: AAH35357
OMIM: 190030,
GeneID: 2242
Lot Number: MM950404136
MA Code: ABVAP62HR
Operation Date: 2006/12/22
Info Abnova CorporationAbnova Corporation
Abnova Corporation (HQ)
9th Fl., No. 108, Jhouzih St.
Neihu District, Taipei
114 Taiwan R.O.C.
Tel: +886-2-8751-1888
Fax: +886-2-8751-1166

Abnova GmbH
Boxbergring 107
69126 Heidelberg
Germany
Tel: +49 6221 3632226
Fax: +49 6221 825878

Customer Service: +886-2-8751-1888
Fax Number: +886-2-8751-1166
Web Site: http://www.abnova.com.tw
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Mouse Anti-Amodiaquine Monoclonal Antibody, Unconjugated, Clone 6D10 from AntibodyShop A/S
2. Mouse Anti-Protein S Monoclonal Antibody, Unconjugated, Clone HYB 232-02 from Abcam
3. Mouse Anti-Mouse Glutathione S-transferase M1 (GSTM1) Monoclonal Antibody, Unconjugated from Lifespan Biosciences
4. Mouse Anti-Human S-100 alpha/beta chain Monoclonal Antibody, Unconjugated, Clone 8B10 from Santa Cruz Biotechnology, Inc.
5. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Testis from OriGene Technologies
6. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Brain (adult) from OriGene Technologies
7. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (12.5 - day) from OriGene Technologies
8. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (19 - day) from OriGene Technologies
9. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Thymus from OriGene Technologies
10. Mouse Anti-Human Complement factor B Monoclonal Antibody, Unconjugated, Clone 9B6 from AntibodyShop A/S
11. Mouse Anti-Human Choriongonadotropin (hCG) Monoclonal Antibody, Unconjugated, Clone 5F10 from AntibodyShop A/S
...
... screen, without Camera • ... mega pixel resolution. It is computer free for ... from large 5.6" TFT color liquid crystal display ... capture image for fluorescent gels, colorimetric gels, auto ...
... is a modular, highly scalable, automated high ... or 3ml industry standard SPE cartridges, the ... in less than two hours unattended. Each ... and up to 10 modules can be ...
... & SSM4, Small space saving design - ideal ... of two models: , - 3D gyratory action ... , Digital speed control and built-in timer , Optional ... rockers are ideal where gentle mixing is required, either ...
Biology Products:
(Date:5/24/2016)... facilitates superior patient care by providing unparalleled technology to leaders of the medical imaging ... product recently added to the range of products distributed by Ampronix. Photo ... ... ... News ...
(Date:5/20/2016)... MINNEAPOLIS , May 20, 2016  VoiceIt ... technology partnership with VoicePass. By working ... user experience.  Because VoiceIt and VoicePass take slightly ... two engines increases both security and usability. ... expressed excitement about this new partnership. ...
(Date:5/16/2016)... , May 16, 2016   EyeLock LLC , ... announced the opening of an IoT Center of Excellence ... and expand the development of embedded iris biometric applications. ... level of convenience and security with unmatched biometric accuracy, ... identity aside from DNA. EyeLock,s platform uses video technology ...
Breaking Biology News(10 mins):
(Date:5/24/2016)... ... May 24, 2016 , ... Cell therapies for a range ... by research at Worcester Polytechnic Institute (WPI) that yielded a newly patented method ... , The novel method, developed by WPI faculty members Raymond Page, PhD, professor ...
(Date:5/24/2016)... 24, 2016   MedyMatch Technology Ltd ., the data ... real-time decision support tools in the emergency room, announced today ... Israeli Advanced Technology Industries (IATI) BioMed Conference. ... 15th National Life Sciences and Technology Week, and is ... Hotel in Tel Aviv, Israel . ...
(Date:5/24/2016)... ... May 24, 2016 , ... Last week, Callan Capital, an integrated ... entrepreneurs, held The Future of San Diego Life Science event at the Estancia La ... community attended the event with speakers Dr. Rich Heyman, former CEO of Aragon and ...
(Date:5/24/2016)... ... May 24, 2016 , ... ... identity. The new Media Cybernetics corporate branding reflects a results-driven revitalization for a ... image analysis. The re-branding components include a crisp, refreshed logo and a new ...
Breaking Biology Technology: