Navigation Links
Mouse Anti-FES Polyclonal Antibody, Unconjugated from Abnova Corporation

ProductsMouse Anti-FES Polyclonal Antibody, Unconjugated from Abnova Corporation
Company Abnova Corporation
Item Mouse Anti-FES Polyclonal Antibody, Unconjugated
Price 
Description Mouse polyclonal antibody raised against a partial recombinant FES.
Immunogen: FES (AAH35357, 120 a.a. ~ 250 a.a) partial recombinant protein with GST tag.
Protein Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA
Accession: BC035357
Protein Accession Number: AAH35357
OMIM: 190030,
GeneID: 2242
Lot Number: MM950404136
MA Code: ABVAP62HR
Operation Date: 2006/12/22
Info Abnova CorporationAbnova Corporation
Abnova Corporation (HQ)
9th Fl., No. 108, Jhouzih St.
Neihu District, Taipei
114 Taiwan R.O.C.
Tel: +886-2-8751-1888
Fax: +886-2-8751-1166

Abnova GmbH
Boxbergring 107
69126 Heidelberg
Germany
Tel: +49 6221 3632226
Fax: +49 6221 825878

Customer Service: +886-2-8751-1888
Fax Number: +886-2-8751-1166
Web Site: http://www.abnova.com.tw
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Mouse Anti-Amodiaquine Monoclonal Antibody, Unconjugated, Clone 6D10 from AntibodyShop A/S
2. Mouse Anti-Protein S Monoclonal Antibody, Unconjugated, Clone HYB 232-02 from Abcam
3. Mouse Anti-Mouse Glutathione S-transferase M1 (GSTM1) Monoclonal Antibody, Unconjugated from Lifespan Biosciences
4. Mouse Anti-Human S-100 alpha/beta chain Monoclonal Antibody, Unconjugated, Clone 8B10 from Santa Cruz Biotechnology, Inc.
5. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Testis from OriGene Technologies
6. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Brain (adult) from OriGene Technologies
7. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (12.5 - day) from OriGene Technologies
8. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (19 - day) from OriGene Technologies
9. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Thymus from OriGene Technologies
10. Mouse Anti-Human Complement factor B Monoclonal Antibody, Unconjugated, Clone 9B6 from AntibodyShop A/S
11. Mouse Anti-Human Choriongonadotropin (hCG) Monoclonal Antibody, Unconjugated, Clone 5F10 from AntibodyShop A/S
... BacMagic™ DNA Kit provides a positive selection ... recombinant protein expression in insect cells. The ... generating recombinant baculoviruses by eliminating the time-consuming ... is an AcNPV genome with a portion ...
... CLS number is a new product number, ... If showing no availability yet, please order ... contact customer service for assistance. ... Dim: surface area 500 cm 2 ...
Mouse Anti-Human Killer cell immunoglobulin-like receptor, two domains, long cytoplasmic tail, 4 (KIR2DL4 Monoclonal Antibody Family: New...
Gridded Cell Culture Petri Dish (20 mm molded in base), tissue-culture treated...
Biology Products:
(Date:10/20/2018)... ... October 19, 2018 , ... ... Hub will be working together to explore and advance the use of ... innovation of digital health care applications that leverage voice assistants, chatbots, and other ...
(Date:10/18/2018)... (PRWEB) , ... October 18, 2018 , ... Drug toxicity ... avoid but needs to be identified and mitigated. Failure to recognize such toxicities ... patient population, as well as a serious challenge to drug developers faced with an ...
(Date:10/18/2018)... ... October 18, 2018 , ... TopConsumerReviews.com ... services that offer direct-to-consumer DNA Testing for health and/or genealogy research purposes. , ... reasons are many: some people want to find out more about their ancestry, ...
Breaking Biology News(10 mins):
(Date:10/18/2018)... ... ... R3 Stem Cell is now offering a 20% Early Bird discount for ... good through November 7th, 2018, with the course taking place December 7-8th in Las ... amazing useful array of hands on therapies with real patients. The first day includes ...
(Date:10/18/2018)... Calif. (PRWEB) , ... October 18, 2018 , ... ... CLIA-certified genomic sequencing laboratory in the San Francisco Bay Area has received accreditation ... quality, operations, and patient safety. , Predicine received CAP accreditation for its Shanghai ...
(Date:10/18/2018)... ... ... With rapid technological advances in the fertility field, increasing numbers of women ... a cancer diagnosis requiring chemotherapy or removal of an ovary, most women who freeze ... do not want to get pregnant now but may want to in the future. ...
(Date:10/17/2018)... ... October 17, 2018 , ... ... and his associate, Dr. Michael Kang, are offering current and new patients the ... results thanks to the emerging, proven treatment technology known as Piezosurgery® . ...
Breaking Biology Technology: