Navigation Links
Mouse Anti-FES Polyclonal Antibody, Unconjugated from Abnova Corporation

ProductsMouse Anti-FES Polyclonal Antibody, Unconjugated from Abnova Corporation
Company Abnova Corporation
Item Mouse Anti-FES Polyclonal Antibody, Unconjugated
Price 
Description Mouse polyclonal antibody raised against a partial recombinant FES.
Immunogen: FES (AAH35357, 120 a.a. ~ 250 a.a) partial recombinant protein with GST tag.
Protein Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA
Accession: BC035357
Protein Accession Number: AAH35357
OMIM: 190030,
GeneID: 2242
Lot Number: MM950404136
MA Code: ABVAP62HR
Operation Date: 2006/12/22
Info Abnova CorporationAbnova Corporation
Abnova Corporation (HQ)
9th Fl., No. 108, Jhouzih St.
Neihu District, Taipei
114 Taiwan R.O.C.
Tel: +886-2-8751-1888
Fax: +886-2-8751-1166

Abnova GmbH
Boxbergring 107
69126 Heidelberg
Germany
Tel: +49 6221 3632226
Fax: +49 6221 825878

Customer Service: +886-2-8751-1888
Fax Number: +886-2-8751-1166
Web Site: http://www.abnova.com.tw
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Mouse Anti-Amodiaquine Monoclonal Antibody, Unconjugated, Clone 6D10 from AntibodyShop A/S
2. Mouse Anti-Protein S Monoclonal Antibody, Unconjugated, Clone HYB 232-02 from Abcam
3. Mouse Anti-Mouse Glutathione S-transferase M1 (GSTM1) Monoclonal Antibody, Unconjugated from Lifespan Biosciences
4. Mouse Anti-Human S-100 alpha/beta chain Monoclonal Antibody, Unconjugated, Clone 8B10 from Santa Cruz Biotechnology, Inc.
5. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Testis from OriGene Technologies
6. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Brain (adult) from OriGene Technologies
7. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (12.5 - day) from OriGene Technologies
8. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (19 - day) from OriGene Technologies
9. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Thymus from OriGene Technologies
10. Mouse Anti-Human Complement factor B Monoclonal Antibody, Unconjugated, Clone 9B6 from AntibodyShop A/S
11. Mouse Anti-Human Choriongonadotropin (hCG) Monoclonal Antibody, Unconjugated, Clone 5F10 from AntibodyShop A/S
Detects activated caspases in living cells. Simple/sensitive/straight-forward procedure takes only 30 minutes. Results can be analyzed by flow cytometry/fluorescence microscopy/fluorescence plate rea...
Anti-Mouse Qa.m7, Ascites (Clone 5035-50.1) (mouse IgM)...
DAPI: 4', 6-Diamino-2-phenylindole dihydrochloride. Antifade Solution: p-Phenylenediamine and glycerol in PBS solution. 0.4g/mL DAPI suspended in Antifade....
... at the 9, 10, 12, and 13 positions. ... standard for the quantification of 13(S)-HODE by GC- ... of linoleic acid with plant and mammalian lipoxygenases. ... of tumor cells to the endothelium at concentrations ...
Biology Products:
(Date:2/8/2017)... 7, 2017 The biometrics market has ... confluence of organizations, desires to better authenticate or ... (password and challenge questions), biometrics is quickly working ... The market is driven by use cases, though ... and enterprise uses cases, with consumer-facing use cases ...
(Date:2/7/2017)... , February 7, 2017 ... Global Solutions Corporation [OTC: IDGS], ("Ipsidy" or the "Company") ... electronic transaction processing services, is pleased to announce the ... Company. Effective January 31, 2017, Philip ... of Directors, CEO and President.  An experienced payment industry ...
(Date:2/2/2017)... , Feb. 2, 2017   TapImmune, ... clinical-stage immuno-oncology company specializing in the development of ... the treatment of cancer and metastatic disease, announced ... and GMP manufacturing of a second clinical lot ... targeting folate receptor alpha. The manufactured vaccine product ...
Breaking Biology News(10 mins):
(Date:2/24/2017)... MA (PRWEB) , ... February 24, 2017 , ... ... replacement (TDR) procedures can be safely completed in an ambulatory surgery center (ASC) ... fusion (ACDF) procedures and previous two-year TDR studies. , Jake Lubinski, president ...
(Date:2/24/2017)... 24, 2017 Provectus Biopharmaceuticals, Inc. (OTCQB: ... a clinical-stage oncology and dermatology biopharmaceutical company, today ... participate in its previously announced rights offering of ... of common stock and Series C Convertible Preferred ... warrants. As previously announced, the ...
(Date:2/24/2017)... , Feb. 24, 2017  Driven by consumers, ... are now the fastest growing categories, finds the ... Actives in Personal Care: Multi-regional Market Analysis and ... management consulting firm Kline. "Biotechnology actives ... make them more effective for skin and hair ...
(Date:2/24/2017)... China Biologic Products, Inc. (NASDAQ: CBPO) ("China Biologic" ... in China, today announced its financial results for the fourth ... Quarter 2016 Financial Highlights Total sales ... RMB terms, or increased by 13.6% in USD terms to ... 2015. Gross profit increased by 13.3% to ...
Breaking Biology Technology: