Navigation Links
Mouse Anti-FES Polyclonal Antibody, Unconjugated from Abnova Corporation

ProductsMouse Anti-FES Polyclonal Antibody, Unconjugated from Abnova Corporation
Company Abnova Corporation
Item Mouse Anti-FES Polyclonal Antibody, Unconjugated
Price 
Description Mouse polyclonal antibody raised against a partial recombinant FES.
Immunogen: FES (AAH35357, 120 a.a. ~ 250 a.a) partial recombinant protein with GST tag.
Protein Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA
Accession: BC035357
Protein Accession Number: AAH35357
OMIM: 190030,
GeneID: 2242
Lot Number: MM950404136
MA Code: ABVAP62HR
Operation Date: 2006/12/22
Info Abnova CorporationAbnova Corporation
Abnova Corporation (HQ)
9th Fl., No. 108, Jhouzih St.
Neihu District, Taipei
114 Taiwan R.O.C.
Tel: +886-2-8751-1888
Fax: +886-2-8751-1166

Abnova GmbH
Boxbergring 107
69126 Heidelberg
Germany
Tel: +49 6221 3632226
Fax: +49 6221 825878

Customer Service: +886-2-8751-1888
Fax Number: +886-2-8751-1166
Web Site: http://www.abnova.com.tw
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Mouse Anti-Amodiaquine Monoclonal Antibody, Unconjugated, Clone 6D10 from AntibodyShop A/S
2. Mouse Anti-Protein S Monoclonal Antibody, Unconjugated, Clone HYB 232-02 from Abcam
3. Mouse Anti-Mouse Glutathione S-transferase M1 (GSTM1) Monoclonal Antibody, Unconjugated from Lifespan Biosciences
4. Mouse Anti-Human S-100 alpha/beta chain Monoclonal Antibody, Unconjugated, Clone 8B10 from Santa Cruz Biotechnology, Inc.
5. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Testis from OriGene Technologies
6. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Brain (adult) from OriGene Technologies
7. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (12.5 - day) from OriGene Technologies
8. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (19 - day) from OriGene Technologies
9. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Thymus from OriGene Technologies
10. Mouse Anti-Human Complement factor B Monoclonal Antibody, Unconjugated, Clone 9B6 from AntibodyShop A/S
11. Mouse Anti-Human Choriongonadotropin (hCG) Monoclonal Antibody, Unconjugated, Clone 5F10 from AntibodyShop A/S
Compound(s) tested through a broad panel of 38 ligand binding and enzyme assays targeting the Central Nervous System. Used to determine selectivity and potential GI liabilities of compounds....
... provides a fast and simple procedure for the ... detergents from small samples of protein. The kit ... as an ion exchanger. Each column is capable ... or basic protein.A complete kit for acidic and ...
... The ProteoSpin Detergent Clean-up Maxi Kit ... the effective removal of SDS, Triton ... The kit employs spin-column chromatography using Norgens ... Each column is capable of processing 0.25 ...
Values of steady state parameters for enzyme activities are determined....
Biology Products:
(Date:8/7/2018)... ... August 06, 2018 , ... BioMedGPS announces ... intelligence platform. Inspired by its medical device customers, BioMedGPS teamed up with a ... the many changes, SmartTRAK 3.0 touts a cleaner look, easier navigation and improved ...
(Date:8/7/2018)... JORDAN, Utah (PRWEB) , ... August 07, 2018 , ... ... solutions, announced today their new CT Cloud Voice and SIP solutions. CT Cloud ... scalable and secure, quality voice solution that is far superior to traditional PBX systems, ...
(Date:8/2/2018)... ... August 02, 2018 , ... ... health innovator Boston Heart Diagnostics to its Lifestyle Medicine Corporate Roundtable, a group ... health care system and a sustainable world. , Boston Heart is transforming ...
Breaking Biology News(10 mins):
(Date:7/31/2018)... JOLIET, Ill. (PRWEB) , ... July 31, 2018 ... ... used cooking oil for 65 years, announces the launch of their new website. ... on the user experience throughout the site. Mahoney partnered with Proceed Innovative to ...
(Date:7/25/2018)... ... July 25, 2018 , ... Dimitrius Anagnos, an evidence-based ... combat inflammation and autoimmune disorders. , The preclinical research assessed biomarkers for ... was reported:, Over 70% decrease in Interleukin (IL-1ß) ...
(Date:7/25/2018)... FISHERS, Ind. (PRWEB) , ... July 25, 2018 ... ... Internet of Things (IoT) Systems Innovator, joined the board of the Indiana India ... India. Nominated and unanimously elected today by the current board of directors, McDonald ...
(Date:7/24/2018)... ... 2018 , ... On August 6, 2018, BioMedGPS will unveil ... just a pretty face, SmartTRAK 3.0’s latest improvements were inspired by its customers ... first online and real-time data portal that specializes in providing competitive market intelligence ...
Breaking Biology Technology: