Navigation Links
Mouse Anti-FES Polyclonal Antibody, Unconjugated from Abnova Corporation

ProductsMouse Anti-FES Polyclonal Antibody, Unconjugated from Abnova Corporation
Company Abnova Corporation
Item Mouse Anti-FES Polyclonal Antibody, Unconjugated
Price 
Description Mouse polyclonal antibody raised against a partial recombinant FES.
Immunogen: FES (AAH35357, 120 a.a. ~ 250 a.a) partial recombinant protein with GST tag.
Protein Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA
Accession: BC035357
Protein Accession Number: AAH35357
OMIM: 190030,
GeneID: 2242
Lot Number: MM950404136
MA Code: ABVAP62HR
Operation Date: 2006/12/22
Info Abnova CorporationAbnova Corporation
Abnova Corporation (HQ)
9th Fl., No. 108, Jhouzih St.
Neihu District, Taipei
114 Taiwan R.O.C.
Tel: +886-2-8751-1888
Fax: +886-2-8751-1166

Abnova GmbH
Boxbergring 107
69126 Heidelberg
Germany
Tel: +49 6221 3632226
Fax: +49 6221 825878

Customer Service: +886-2-8751-1888
Fax Number: +886-2-8751-1166
Web Site: http://www.abnova.com.tw
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Mouse Anti-Amodiaquine Monoclonal Antibody, Unconjugated, Clone 6D10 from AntibodyShop A/S
2. Mouse Anti-Protein S Monoclonal Antibody, Unconjugated, Clone HYB 232-02 from Abcam
3. Mouse Anti-Mouse Glutathione S-transferase M1 (GSTM1) Monoclonal Antibody, Unconjugated from Lifespan Biosciences
4. Mouse Anti-Human S-100 alpha/beta chain Monoclonal Antibody, Unconjugated, Clone 8B10 from Santa Cruz Biotechnology, Inc.
5. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Testis from OriGene Technologies
6. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Brain (adult) from OriGene Technologies
7. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (12.5 - day) from OriGene Technologies
8. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (19 - day) from OriGene Technologies
9. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Thymus from OriGene Technologies
10. Mouse Anti-Human Complement factor B Monoclonal Antibody, Unconjugated, Clone 9B6 from AntibodyShop A/S
11. Mouse Anti-Human Choriongonadotropin (hCG) Monoclonal Antibody, Unconjugated, Clone 5F10 from AntibodyShop A/S
... monoclonal antibody which can immunocapture up to ... mitochondria. Also included are 2 mg of ... Complex V immunocapture kit allows isolation of ... small amounts of tissue. This facilitates subsequent ...
ANXA11 Immunogen: ANXA11 (NP_001148, 406 a.a. ~ 506 a.a) partial recombinant protein with GST tag. Storage: -20 C, Avoid Freeze/Thaw Cycles *Available for distribution in the US only...
Anti-ADAM-12 (Meltrin Alpha); carboxy terminal end; rabbit host...
Anti-Flavocytochrome b Monoclonal, FITC Labeled Research Focus: other Storage: 4C Shipping Temperature: 4C...
Biology Products:
(Date:12/19/2018)... ROCHELLE, Va. (PRWEB) , ... December 19, 2018 , ... ... former Scientific Reviewer and Compliance Officer at the FDA Center for Devices and Radiological ... with NDA Partners as an Expert Consultant since 2015, and she has more than ...
(Date:12/18/2018)... ... December 18, 2018 , ... The nation’s leader in ... marketing. The technology has been effective at reducing patient acquisition costs by over ... with clients nationwide on patient acquisition marketing programs. Traditional marketing for stem cell ...
(Date:12/14/2018)... (PRWEB) , ... December 14, 2018 , ... ... patent number 9,703,929 entitled “Method and System for Microbiome-Derived Diagnostics and Therapeutics” by ... date of October 21, 2014. The patent is an invention by uBiome collaborators ...
Breaking Biology News(10 mins):
(Date:12/18/2018)... BARBARA, Calif. (PRWEB) , ... December 18, 2018 ... ... innovation and business process optimization firm for the life sciences industry, unveiled a ... educational content while creating a more user-friendly browsing experience for their valued clients ...
(Date:12/13/2018)... ... 11, 2018 , ... Researchers at Worcester Polytechnic Institute (WPI) ... Clostridium difficile (C. diff), a dangerous and sometimes fatal gastrointestinal infection. The sensor ... used onsite in doctor’s offices and nursing homes, providing results in minutes instead ...
(Date:12/13/2018)... FRANKLIN, Wis. (PRWEB) , ... December 13, 2018 ... ... HACCP scope which now includes food (human) ingredient. This has been part of ... Having a Food Safety Plan and certification creates custom fermentation opportunities for MDG ...
(Date:12/5/2018)... ... 2018 , ... The incredible life story of former refugee and LG Sonic ... Carlos Moedas, the European Commissioner for Research and Innovation. , In his November ... Commissioner Moedas spoke at length of Yousef’s life and journey, citing the man who ...
Breaking Biology Technology: