Navigation Links
Mouse Anti-FES Polyclonal Antibody, Unconjugated from Abnova Corporation

ProductsMouse Anti-FES Polyclonal Antibody, Unconjugated from Abnova Corporation
Company Abnova Corporation
Item Mouse Anti-FES Polyclonal Antibody, Unconjugated
Price 
Description Mouse polyclonal antibody raised against a partial recombinant FES.
Immunogen: FES (AAH35357, 120 a.a. ~ 250 a.a) partial recombinant protein with GST tag.
Protein Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA
Accession: BC035357
Protein Accession Number: AAH35357
OMIM: 190030,
GeneID: 2242
Lot Number: MM950404136
MA Code: ABVAP62HR
Operation Date: 2006/12/22
Info Abnova CorporationAbnova Corporation
Abnova Corporation (HQ)
9th Fl., No. 108, Jhouzih St.
Neihu District, Taipei
114 Taiwan R.O.C.
Tel: +886-2-8751-1888
Fax: +886-2-8751-1166

Abnova GmbH
Boxbergring 107
69126 Heidelberg
Germany
Tel: +49 6221 3632226
Fax: +49 6221 825878

Customer Service: +886-2-8751-1888
Fax Number: +886-2-8751-1166
Web Site: http://www.abnova.com.tw
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Mouse Anti-Amodiaquine Monoclonal Antibody, Unconjugated, Clone 6D10 from AntibodyShop A/S
2. Mouse Anti-Protein S Monoclonal Antibody, Unconjugated, Clone HYB 232-02 from Abcam
3. Mouse Anti-Mouse Glutathione S-transferase M1 (GSTM1) Monoclonal Antibody, Unconjugated from Lifespan Biosciences
4. Mouse Anti-Human S-100 alpha/beta chain Monoclonal Antibody, Unconjugated, Clone 8B10 from Santa Cruz Biotechnology, Inc.
5. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Testis from OriGene Technologies
6. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Brain (adult) from OriGene Technologies
7. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (12.5 - day) from OriGene Technologies
8. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (19 - day) from OriGene Technologies
9. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Thymus from OriGene Technologies
10. Mouse Anti-Human Complement factor B Monoclonal Antibody, Unconjugated, Clone 9B6 from AntibodyShop A/S
11. Mouse Anti-Human Choriongonadotropin (hCG) Monoclonal Antibody, Unconjugated, Clone 5F10 from AntibodyShop A/S
The new Silencer siRNA Starter Kit is perfect for researchers new to RNAi. It provides all of the reagents, protocols, and instructions necessary to get underway with siRNA transfection and ensure su...
... in plasma from juvenile or male fish is ... chemicals (EDCs) with estrogenic effects in fish. Quantification ... for the estrogenic effects of EDCs in fish. ... double-antibody immunometric (sandwich) EIA for analyzing Vtg in ...
... synthetic peptide whose sequence is from rat SCAMP 5. The ... - N(217) - Q - P - Q - T - ... - N - Y - T - Y - S - ... control experiments with the polyclonal antibody that reacts with this product ...
... a novel target for which no antibody exists? ... custom antibodies for a variety of pharmaceutical, biotech ... to put our technology and expertise in antibody ... to our patented RabMAb development technology , High ...
Biology Products:
(Date:9/19/2014)... dinosaurs a newly discovered hadrosaur with a ... Rhinorex condrupus by paleontologists from North ... in what is now Utah approximately 75 million ... Rhinorex, which translates roughly into "King Nose," was ... Cretaceous hadrosaurs like Parasaurolophus and Edmontosaurus. Hadrosaurs are ...
(Date:9/19/2014)... by researchers from several Harvard University labs in ... and aspiring researchers with the intellectual raw materials ... from soft, flexible materials. , With the advent ... advances in manufacturing technology, soft robotics is emerging ... from conventional rigid robot design, but working with ...
(Date:9/19/2014)... the unique bioelectric signaling system of the electric fish, ... The OU researcher is working to understand how these ... used to map the world around them. Electric ... discharges a second throughout their lives. The energetic ... necessary for survival. , "There is evidence that electric ...
Breaking Biology News(10 mins):New hadrosaur noses into spotlight 2Soft robotics 'toolkit' features everything a robot-maker needs 2
... researchers sometimes need to put on the hip waders, pull ... compares to the real world. According to a Stanford University ... of Science, Mother Nature is more predictable than lab experiments ... stickleback, nature took advantage of the same genetic trick time ...
... scientists report in the journal Nature that the "missing" ... up by splicing together sequences in distant parts of ... Dieter Söll in the Department of Molecular Biophysics and ... with a known genome sequence. Nanoarchaeum equitans, is a ...
... the University of Cincinnati (UC) College of Medicine have ... stroke known as cerebral vasospasm. , A constriction of ... occurs three to 10 days following a massive brain ... who survive the initial stroke develop vasospasm, and 40 ...
Cached Biology News:Same mutation aided evolution in many fish species, Stanford study finds 2Same mutation aided evolution in many fish species, Stanford study finds 3Researchers find missing genes of ancient organism 2Researchers discover molecule that causes secondary stroke 2
(Date:9/20/2014)... and PITTSFIELD, Massachusetts, USA (PRWEB) September 20, 2014 ... for the prestigious 2015 Prism Awards for Photonics ... product inventions from the multi-billion dollar optics and photonics ... society for optics and photonics , and Photonics ... as well as the versatility of photonics, said SPIE ...
(Date:9/20/2014)... HealthTronics, Inc. , a leading ... and services, has signed a distribution agreement through ... for its high precision laser technology. ... mobile, surgical technology—offering more choices for healthcare providers ... will make available Clinicon’s FDA-cleared SureLase™ CO2 Laser ...
(Date:9/20/2014)... MediVet America and NanoFiber ... surgery at the specialized Wolvega Horse Clinic. , Due ... tendon was ruptured 90% and her deep digital flexor ... death sentence for a horse. , The clinic has ... . This revolutionary regenerative option for ruptured tendons ...
(Date:9/19/2014)... Sept. 19, 2014  InterMune, Inc. (Nasdaq: ... Memorandum of Understanding to settle the litigation in the ... Plan of Merger dated as of August 22, 2014, ... Inc.  As one term of the Memorandum of Understanding, ... forth in the attached exhibit reflecting the amendment to ...
Breaking Biology Technology:Entry deadline is 10 October for international photonics Prism Awards 2Entry deadline is 10 October for international photonics Prism Awards 3Entry deadline is 10 October for international photonics Prism Awards 4HealthTronics Announces Distribution Agreement with Clinicon-Laser Surgical Device Expands Minimally Invasive, Mobile Technology Portfolio 2HealthTronics Announces Distribution Agreement with Clinicon-Laser Surgical Device Expands Minimally Invasive, Mobile Technology Portfolio 3World’s first tendon replacement using Nanofiber and activated MediVet Stem Cell Fraction 2World’s first tendon replacement using Nanofiber and activated MediVet Stem Cell Fraction 3InterMune Reports Memorandum of Understanding in Connection with Consolidated Delaware Action 2InterMune Reports Memorandum of Understanding in Connection with Consolidated Delaware Action 3InterMune Reports Memorandum of Understanding in Connection with Consolidated Delaware Action 4InterMune Reports Memorandum of Understanding in Connection with Consolidated Delaware Action 5InterMune Reports Memorandum of Understanding in Connection with Consolidated Delaware Action 6InterMune Reports Memorandum of Understanding in Connection with Consolidated Delaware Action 7InterMune Reports Memorandum of Understanding in Connection with Consolidated Delaware Action 8InterMune Reports Memorandum of Understanding in Connection with Consolidated Delaware Action 9InterMune Reports Memorandum of Understanding in Connection with Consolidated Delaware Action 10InterMune Reports Memorandum of Understanding in Connection with Consolidated Delaware Action 11InterMune Reports Memorandum of Understanding in Connection with Consolidated Delaware Action 12InterMune Reports Memorandum of Understanding in Connection with Consolidated Delaware Action 13InterMune Reports Memorandum of Understanding in Connection with Consolidated Delaware Action 14InterMune Reports Memorandum of Understanding in Connection with Consolidated Delaware Action 15InterMune Reports Memorandum of Understanding in Connection with Consolidated Delaware Action 16InterMune Reports Memorandum of Understanding in Connection with Consolidated Delaware Action 17InterMune Reports Memorandum of Understanding in Connection with Consolidated Delaware Action 18InterMune Reports Memorandum of Understanding in Connection with Consolidated Delaware Action 19