Navigation Links
Mouse Anti-FES Polyclonal Antibody, Unconjugated from Abnova Corporation

ProductsMouse Anti-FES Polyclonal Antibody, Unconjugated from Abnova Corporation
Company Abnova Corporation
Item Mouse Anti-FES Polyclonal Antibody, Unconjugated
Price 
Description Mouse polyclonal antibody raised against a partial recombinant FES.
Immunogen: FES (AAH35357, 120 a.a. ~ 250 a.a) partial recombinant protein with GST tag.
Protein Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA
Accession: BC035357
Protein Accession Number: AAH35357
OMIM: 190030,
GeneID: 2242
Lot Number: MM950404136
MA Code: ABVAP62HR
Operation Date: 2006/12/22
Info Abnova CorporationAbnova Corporation
Abnova Corporation (HQ)
9th Fl., No. 108, Jhouzih St.
Neihu District, Taipei
114 Taiwan R.O.C.
Tel: +886-2-8751-1888
Fax: +886-2-8751-1166

Abnova GmbH
Boxbergring 107
69126 Heidelberg
Germany
Tel: +49 6221 3632226
Fax: +49 6221 825878

Customer Service: +886-2-8751-1888
Fax Number: +886-2-8751-1166
Web Site: http://www.abnova.com.tw
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Mouse Anti-Amodiaquine Monoclonal Antibody, Unconjugated, Clone 6D10 from AntibodyShop A/S
2. Mouse Anti-Protein S Monoclonal Antibody, Unconjugated, Clone HYB 232-02 from Abcam
3. Mouse Anti-Mouse Glutathione S-transferase M1 (GSTM1) Monoclonal Antibody, Unconjugated from Lifespan Biosciences
4. Mouse Anti-Human S-100 alpha/beta chain Monoclonal Antibody, Unconjugated, Clone 8B10 from Santa Cruz Biotechnology, Inc.
5. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Testis from OriGene Technologies
6. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Brain (adult) from OriGene Technologies
7. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (12.5 - day) from OriGene Technologies
8. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (19 - day) from OriGene Technologies
9. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Thymus from OriGene Technologies
10. Mouse Anti-Human Complement factor B Monoclonal Antibody, Unconjugated, Clone 9B6 from AntibodyShop A/S
11. Mouse Anti-Human Choriongonadotropin (hCG) Monoclonal Antibody, Unconjugated, Clone 5F10 from AntibodyShop A/S
...
... BD PhosFlow Perm/Wash Buffer I can be ... signaling proteins to permeabilize cells and to ... wash buffer. Because saponin-mediated cell permeabilization is ... keep the cells in the presence of ...
... Mouse polyclonal antibody raised against ... Immunogen: PPP4C ... a.a) partial recombinant protein with ... Accession Number: NM_002720 ...
... Thermomixer R offers maximum application versatility ... heating, and cooling. Its active heating/cooling ... and temperature control ranges. Five different ... micro test tubes, are available for: ...
Biology Products:
(Date:5/5/2015)... , May 5, 2015, NXT-ID, Inc. (NASDAQ: ... company focused on the growing mobile commerce market, reminds investors ... Chief Technology Officer, is presenting  at CARTES SECURE CONNEXIONS AMERICA ... 5-7, 2015. The three-day conference is organized ... is speaking in is themed Global Fraud: Where is ...
(Date:4/21/2015)... Canada , April 21, 2015 ... and evolving government policies are boosting access control systems ... According to a recently published report by ... Opportunities, 2020 ", the access control systems market in ... nearly USD1.2 billion by 2020.The access control systems market ...
(Date:4/14/2015)... , April 14, 2015  HYPR Corp. ... Online (FIDO ® ) Alliance tm , an ... FIDO members commit to share technology and collaborate ... that are interoperable, more secure and private, and ... biometric identity verification that protects sensitive user information ...
Breaking Biology News(10 mins):NXT-ID, Inc.'s CTO, David Tunnell, Presents at CARTES SECURE CONNEXIONS AMERICA 2015 Today in Washington DC. 2NXT-ID, Inc.'s CTO, David Tunnell, Presents at CARTES SECURE CONNEXIONS AMERICA 2015 Today in Washington DC. 3Saudi Arabia Access Control Systems Market to Touch USD1.2 Billion by 2020 Says TechSci Research 2Saudi Arabia Access Control Systems Market to Touch USD1.2 Billion by 2020 Says TechSci Research 3HYPR Corp. Joins the FIDO Alliance 2HYPR Corp. Joins the FIDO Alliance 3
... 18.3.2013 In the fruit fly Drosophila , the functions ... intertwined - among other things they are involved in neurotransmitter ... of Biochemistry showed for the first time that flies cannot ... also raises new questions as to its function. Anna Ziegler, ...
... 18, 2013 Labrys Biologics Inc., a company focused on ... lead the development of RN-307, a Phase 2 ready anti-CGRP ... M.D., Ph.D., joins Labrys as chief medical officer, along with ... of project management; Michele Bronson , Ph.D., ...
... Researchers at Albert Einstein College of Medicine of Yeshiva ... found that macrophages white blood cells that play a key ... and eliminate the body,s red blood cells (RBCs). The findings could ... red blood cell production is thrown out of balance. The study, ...
Cached Biology News:Blind flies without recycling 2Blind flies without recycling 3Labrys Biologics Announces Key Executive Appointments 2Labrys Biologics Announces Key Executive Appointments 3Labrys Biologics Announces Key Executive Appointments 4White blood cells found to play key role in controlling red blood cell levels 2White blood cells found to play key role in controlling red blood cell levels 3
(Date:5/27/2015)... Calif. , May 27, 2015  Ceres, Inc. ... been awarded a U.S. patent for a genetic sequence ... areas such as research, product development and plant transformation. ... regulating key biosynthetic processes that are the target of ... other seed companies a commercial license to the innovation, ...
(Date:5/26/2015)... (PRWEB) May 26, 2015 The ... with the Max Planck Society establishing the ... Photonics. The center will link two of the world's ... will be only the third Max Planck Centre in ... international society for optics and photonics, was with ...
(Date:5/26/2015)... and HILDEN, Germany , ... N.V. (NASDAQ: QGEN ; Frankfurt Prime Standard: ... QIAGEN Clinical Insight ® (QCI™) bioinformatics content ... interpret and report on genomic variants identified in ... for the bioinformatics platform are in oncology, for ...
(Date:5/26/2015)... Global Stem Cells Group ... the company’s first cellular and regenerative medicine symposium in ... day, hands-on stem cell training class Oct. 10. The ... M.D., President of Therapeutic Confrontations (CONFTERA) in Barcelona. ... in regenerative medicine and recent advances in cellular therapies, ...
Breaking Biology Technology:Ceres Awarded Patent for Innovation in Soybean 2Ceres Awarded Patent for Innovation in Soybean 3Third Max Planck Centre in North America Inaugurated at University of Ottawa 2Third Max Planck Centre in North America Inaugurated at University of Ottawa 3QIAGEN Launches Clinical Bioinformatics Platform for Next-Generation Sequencing 2QIAGEN Launches Clinical Bioinformatics Platform for Next-Generation Sequencing 3QIAGEN Launches Clinical Bioinformatics Platform for Next-Generation Sequencing 4QIAGEN Launches Clinical Bioinformatics Platform for Next-Generation Sequencing 5Stem Cell Training, Inc. Announces First European Symposium on Cellular and Regenerative Medicine 2Stem Cell Training, Inc. Announces First European Symposium on Cellular and Regenerative Medicine 3