Navigation Links
Marker for 2D Electrophoresis from Sigma-Aldrich

ProductsMarker for 2D Electrophoresis from Sigma-Aldrich
Company Sigma-Aldrich
Item Marker for 2D Electrophoresis
Price 
Description This marker is specifically designed for two-dimensional electrophoresis (2D) and denaturing (urea) IEF. The four proteins in this marker have been selected to provide a diagonal pattern across a 2D gel. The pI range is 7.6 to 3.8.

Mol wt: 17,000-89,000
Physical Form: urea solution
Info Sigma-AldrichSigma-Aldrich
Sigma-Aldrich Corp.
St. Louis, MO, USA
Customer Service: 800-325-3010
Tech Support: 800-325-5832
Fax Number: 314-771-5757
Web Site: http://www.sigmaaldrich.com/
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Strep•Tag® II Perfect Protein™ Markers, 16–100 kDa, Lyophilized from Novagen
2. dsRNA Marker from Abnova Corporation
3. GeneMarker from SoftGenetics, LLC.
4. High Molecular Weight DNA Markers from Invitrogen
5. Embryonic Stem Cell Marker Antibody Panels from R&D Systems
6. Human Embryonic Stem Cell Marker Antibody Panel. Contains 25 g each of anti-Alkaline Phosphatase, anti-Nanog, anti-Oct-3/4, anti-SSEA-1, and anti-SSEA-4. from R&D Systems
7. Mouse Anti-Human Gastric Carcinoma Marker [BY-1] Monoclonal Antibody, Unconjugated, Clone 3H11 from Santa Cruz Biotechnology, Inc.
8. Anti-sm (Smith Antigen) (SLE / Nuclear Marker) Ab-1 Monoclonal Antibody, Unconjugated from Lab Vision
9. Anti-Renal Cell Carcinoma Marker (gp200) Ab-1 Monoclonal Antibody, Unconjugated from Lab Vision
10. Mouse Anti-Human Myeloid Marker Monoclonal Antibody, Unconjugated, Clone BM-1 from Santa Cruz Biotechnology, Inc.
11. [14C] Methylated Protein Molecular Weight Markers from GE Healthcare, formerly Amersham Biosciences
... proteins in polyacrylamide gel after SDS ... ng of protein) with *CoomassieR-G250. All ... can be performed in 1.5 hr. ... proteins can be seen before destaining. ...
Mouse monoclonal antibody raised against a partial recombinant PASK. NCBI Entrez Gene ID = PASK...
Mouse monoclonal antibody raised against a partial recombinant CRKRS. NCBI Entrez Gene ID = CRKRS...
... raised against a partial recombinant FES. ... a.a. ~ 250 a.a) partial recombinant protein ... Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA Accession: ... Number: AAH35357 OMIM: ...
Biology Products:
(Date:3/30/2017)... ANGELES , March 30, 2017  On April ... Hack the Genome hackathon at Microsoft,s ... exciting two-day competition will focus on developing health and ... Hack the Genome is the ... been tremendous. The world,s largest companies in the genomics, ...
(Date:3/28/2017)... India , March 28, 2017 ... IP, Biometrics), Hardware (Camera, Monitors, Servers, Storage Devices), Software ... Vertical, and Region - Global Forecast to 2022", published ... Billion in 2016 and is projected to reach USD ... between 2017 and 2022. The base year considered for ...
(Date:3/23/2017)... The report "Gesture Recognition and Touchless Sensing Market by ... Global Forecast to 2022", published by MarketsandMarkets, the market is expected to be ... 2017 and 2022. Continue Reading ... ... ...
Breaking Biology News(10 mins):
(Date:10/12/2017)... , ... October 12, 2017 , ... ... Vilnius, Lithuania, announced today that they have entered into a multiyear collaboration to ... provide CRISPR researchers with additional tools for gene editing across all applications. , ...
(Date:10/12/2017)... ... 12, 2017 , ... AMRI, a global contract research, development ... patient outcomes and quality of life, will now be offering its impurity solutions ... new regulatory requirements for all new drug products, including the finalization of ICH ...
(Date:10/11/2017)... ... October 11, 2017 , ... The CRISPR-Cas9 system ... experiments and avoiding the use of exogenous expression plasmids. The simplicity of programming ... systematic gain-of-function studies. , This complement to loss-of-function studies, such as with ...
(Date:10/11/2017)... , ... October 11, 2017 , ... ... announced today it will be hosting a Webinar titled, “Pathology is going digital. ... Associates , on digital pathology adoption best practices and how Proscia improves lab ...
Breaking Biology Technology: