Navigation Links
M-MLV Reverse Transcriptase from USB Corp.

ProductsM-MLV Reverse Transcriptase from USB Corp.
Company USB Corp.
Item M-MLV Reverse Transcriptase
Price 
Description Source: E. coli strain containing an overproducing clone of M-MLV Reverse Transcriptase.

M-MLV Reverse Transcriptase catalyzes the polymerization of DNA using template DNA, RNA or RNA:DNA hybrids(1). Full-length copies of large mRNAs, >10 kb, may be synthesized. M-MLV Reverse Transcriptase has a much lower RNase H activity than AMV Reverse Transcriptase resulting in high yields of full length cDNA(2). This makes M-MLV Reverse Transcriptase very useful in cDNA synthesis and RT-PCR.

Shipped on dry ice. Store at -20C.
Info USB Corp.USB Corp.
26111 Miles Road
Cleveland Ohio 44128


Call USB Corp. to buy products (US and Canada only; other locations use numbers below)
USA Canada 1-216-245-1829
Customer Service: 216.765.5000
Fax Number: 216.464.5075
Web Site: http://www.usbweb.com
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. M-MLV Reverse Transcriptase from Promega
2. Reverse-iT One-Step Kit, ReddyMix from ABgene
3. AMV Reverse Transcriptase from Promega
4. Reverse Transcriptase AMV; RNA dependent DNA polymerase from Roche Applied Science
5. SuperScript II RNase H- Reverse Transcriptase from Invitrogen
6. SuperScript II RNase H- Reverse Transcriptase from Invitrogen
7. ARCA (Anti Reverse Cap Analog) from Ambion
8. MultiScribe Reverse Transcriptase from Applied Biosystems
9. SuperScript III RNase H- Reverse Transcriptase from Invitrogen
10. Lambda GT11 Reverse DNA Sequencing Primer from EPICENTRE Biotechnologies
11. pCC1BAC/plndigoBAC-5 Reverse Sequencing Primer from EPICENTRE Biotechnologies
... a partial recombinant FES. ... 250 a.a) partial recombinant protein with GST ... WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA Accession: BC035357 ... AAH35357 OMIM: 190030, ...
Mouse monoclonal antibody raised against a partial recombinant PRKG1. NCBI Entrez Gene ID = PRKG1...
... raised against a partial recombinant ... PPP4C (NP_002711, 218 a.a. ... protein with GST tag. ... NM_002720 Protein ...
Mouse monoclonal antibody raised against a full length recombinant GPT. NCBI Entrez Gene ID = GPT...
Biology Products:
(Date:6/20/2016)... 2016 Securus Technologies, a leading provider ... public safety, investigation, corrections and monitoring announced that ... has secured the final acceptance by all three ... Access Systems (MAS) installed. Furthermore, Securus will have ... installed by October, 2016. MAS distinguishes between legitimate ...
(Date:6/15/2016)... York , June 15, 2016 ... new market report titled "Gesture Recognition Market by Application ... Forecast, 2016 - 2024". According to the report, the  ... 11.60 billion in 2015 and is estimated to ... USD 48.56 billion by 2024.  Increasing ...
(Date:6/9/2016)... Paris Police Prefecture and ... ensure the safety of people and operations in several locations ... Teleste, an international technology group specialised in broadband ... its video security solution will be utilised by ... across the country. The system roll-out is scheduled for the ...
Breaking Biology News(10 mins):
(Date:6/23/2016)... , June 23, 2016 Apellis Pharmaceuticals, ... 1 clinical trials of its complement C3 inhibitor, ... and multiple ascending dose studies designed to assess ... of subcutaneous injection in healthy adult volunteers. ... either as a single dose (ranging from 45 ...
(Date:6/23/2016)... -- Andrew D Zelenetz , ... Published recently in Oncology & ... Andrew D Zelenetz , discusses the fact ... placing an increasing burden on healthcare systems worldwide, ... the patents on many biologics expiring, interest in ...
(Date:6/23/2016)... ... June 23, 2016 , ... ClinCapture, the only ... Center and will showcase its product’s latest features from June 26 to June ... scientific poster on Disrupting Clinical Trials in The Cloud during the conference. ...
(Date:6/23/2016)... ... June 23, 2016 , ... Velocity Products, a division of ... and optimized exclusively for Okuma CNC machining centers at The International Manufacturing Technology ... among several companies with expertise in toolholding, cutting tools, machining dynamics and distribution, ...
Breaking Biology Technology: