Navigation Links
Latex Gloves, PF- small from Santa Cruz Biotechnology, Inc.
Mouse monoclonal antibody raised against a partial recombinant DENR. NCBI Entrez Gene ID = DENR...
Mouse monoclonal antibody raised against a partial recombinant IL31RA. NCBI Entrez Gene ID = IL31RA...
... raised against a partial recombinant NFKBIB. ... 145 a.a) partial recombinant protein with GST tag. ... Accession: BC015528 ... OMIM: 604495, GeneID: ...
... Mouse polyclonal antibody raised against a ... FES (AAH35357, 120 a.a. ~ 250 ... Protein Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA ... Protein Accession Number: AAH35357 ...
Biology Products:
(Date:8/29/2014)... from the University of Texas Medical Branch at Galveston has ... antibodies can completely protect monkeys against a lethal dose of ... time when the disease is severe. , Thomas Geisbert, professor ... Nature discussing advances in Ebola treatment research. The filoviruses ... most deadly of pathogens, with fatality rates of up to ...
(Date:8/29/2014)... This news release is available in German . ... are key players in the natural nitrogen cycle on ... these specialist bacteria were thought to depend on nitrite ... scientists led by Holger Daims, a microbiologist at the ... can use hydrogen as an alternative source of energy. ...
(Date:8/29/2014)... nucleus, chromosomal DNA is tightly bound to structural ... chromatin. Until about two decades ago, histones were ... material around which the glamorous DNA strands were ... appreciation for how DNA/histone interactions govern gene expression. ... studying the sequence of the genome from cancer ...
Breaking Biology News(10 mins):Leading Ebola researcher at UTMB says there's an effective treatment for Ebola 2Hydrogen powers important nitrogen-transforming bacteria 2Hydrogen powers important nitrogen-transforming bacteria 3'K-to-M' histone mutations: How repressing the repressors may drive tissue-specific cancers 2'K-to-M' histone mutations: How repressing the repressors may drive tissue-specific cancers 3
... that some strains of algae, when starved of nutrients, quickly ... the discovery lay dormant until people began to search in ... early 2000s, algal fuel production enjoyed a tremendous vogue, as ... converting "pond scum" to oil. But a recent wave of ...
... 13, 2011 Studies have estimated that converting manure from the ... renewable energy equal to 8 billion gallons of gasoline, or ... Because more and more farmers and communities are interested in ... need for information on the economic feasibility and sustainability of ...
... This press release is available in German . ... long been assumed. This is the conclusion of a study in ... of four major European rivers. It was revealed that 38 per ... have an effect on organisms. According to scientists writing in the ...
Cached Biology News:WUSTL wins $ 2.2 million US Department of Energy grant to build a fuel producing bacterium 2WUSTL wins $ 2.2 million US Department of Energy grant to build a fuel producing bacterium 3WUSTL wins $ 2.2 million US Department of Energy grant to build a fuel producing bacterium 4Does converting cow manure to electricity pay off? 2Pesticides pollute European waterbodies more than previously thought 2Pesticides pollute European waterbodies more than previously thought 3Pesticides pollute European waterbodies more than previously thought 4
(Date:8/28/2014)... 2014 SPIE Fellow Glenn Boreman, Professor ... Science and Director of the Center for Optoelectronics and ... Charlotte, and co-founder and Chairman of the Board of ... 2015 Vice President of SPIE, the international society for ... announced recent election results at the Annual General Meeting ...
(Date:8/28/2014)... A new research platform uses a ... tiny structures undergoing stress and heating, an ... designs for microelectronics and batteries., This new ... about how heating and the surface stress ... Researchers have discussed the merits of surface-stress ...
(Date:8/28/2014)... BOSTON , Aug. 28, 2014  Next month, executives ... at three key industry events beginning with Patient-Centered Clinical ... Hotel in Boston , September 4-5. Patient ... , and Aaron Fleishman will share insights on ... how a variety of tactics – from media to mobile ...
(Date:8/28/2014)... Florida State University research team has led to a ... white light, and convert photon energy directly to mechanical ... , Biwu Ma, associate professor in the Department of ... Engineering, created the molecule in a lab about a ... creation has many other unique capabilities. , For example, ...
Breaking Biology Technology:Glenn Boreman, UNC Professor and Plasmonics Co-Founder, Elected to SPIE Presidential Chain 2New analytical technology reveals 'nanomechanical' surface traits 2New analytical technology reveals 'nanomechanical' surface traits 3BBK Worldwide Leads Sessions at Key September Events 2Novel 'butterfly' molecule could build new sensors, photoenergy conversion devices 2