Navigation Links
JMP from JMP

ProductsJMP from JMP
Company JMP
Item JMP
Price Inquire
Description JMP 6 delivers enhanced statistics and statistical interpretation to researchers, product innovators, and quality improvement managers. As an accepted organizational standard for analytics worldwide, JMP 6 simplifies statistics for novice users and includes the comprehensive analytics needed by experts. It offers a powerful JMP Scripting Language (JSL), a menu generator, and journaling tools that capture analytic sequences and make them available for replay throughout an organization.
Info JMPJMP
SAS Campus Drive
Cary, NC 27513
Customer Service: (919) 677-8000
Fax Number: (919) 677-4444
Web Site: http://www.jmp.com
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Standard Protein Kinase Substrate (PKS) Peptide Microarray from LC Sciences
2. Protein Kinase Substrate (PKS) Peptide Microarray - Comprehensive Service from LC Sciences
3. Custom Protein Kinase Substrate (PKS) Peptide Microarray from LC Sciences
4. Goat Anti-Pyruvate Kinase Polyclonal Antibody, Unconjugated from AbD Serotec
5. T4 Polynucleotide Kinase from EPICENTRE Biotechnologies
6. Mouse Anti-Rat L-Pyruvate Kinase Monoclonal Antibody, Unconjugated, Clone AD12 from ScheBo Biotech AG
7. Mouse Anti-Guanylate Kinase Monoclonal Antibody, Unconjugated, Clone 28 from BD Biosciences Pharmingen
8. T4 Polynucleotide Kinase from Promega
9. Rabbit Anti-Human Janus Kinase 2 (JAK2) Polyclonal Antibody, Unconjugated from Lifespan Biosciences
10. Anti-CaMKII (Calmodulin-dependent Protein Kinase II) Monoclonal Antibody, Unconjugated, Clone 6G9 (2) from CHEMICON
11. Universal Kinase / Phosphatase Fluorescence superquenching Assay Kit, TruLight™ from Calbiochem
Mouse monoclonal antibody raised against a full length recombinant CSNK2A2. NCBI Entrez Gene ID = CSNK2A2...
... DNA Visualizer Extraction Kit is manufactured ... causing DNA damage byexposure to UV light. ... gel is often used for DNA-cloning work. ... ethidium bromide and exposure of UV light ...
... Mouse monoclonal antibody raised against a partial ... (AAH39825, 358 a.a. ~ 457 a.a) partial recombinant ... Sequence: PPKQQSQEKPPQTLFPSIVKNMPTKPNGTLSHKSGRRRWGQTIFKSGDSWEELEDYDFGASHSKKPSMGVFKEKRKKDSPFRQQVKMAVISLSAHQFPTL Accession: ... AAH39825 OMIM: 154235, ...
Mouse monoclonal antibody raised against a partial recombinant L3MBTL2. NCBI Entrez Gene ID = L3MBTL2...
Biology Products:
(Date:4/17/2014)... a novel method to help kidney stone sufferers ... treatment possible., Kidney stones represent a major medical ... left untreated, apart from being particularly painful, they ... In many patients treated successfully, stone recurrence is ... approach to diagnosis and treatment needs to be ...
(Date:4/17/2014)... whereby the genetic information of DNA is used ... have numerous different functions in living organisms. Messenger ... gene expression, by relating the genetic information of ... proteins. , By examining the different types ... organism at a given time, researchers can determine ...
(Date:4/17/2014)... View of Domestication," a special feature of The ... ( PNAS ) published April 29, raises a ... deep history that most of us take for granted. ... in many spots around the globe shifted from hunting ... and plants. , It seems so straightforward and yet ...
Breaking Biology News(10 mins):Rapid and accurate mRNA detection in plant tissues 2Genetic study tackles mystery of slow plant domestications 2Genetic study tackles mystery of slow plant domestications 3Genetic study tackles mystery of slow plant domestications 4
... NYJuly 28, 2011A new study co-authored by Columbia Engineering ... Environmental Science & Technology , shows that reducing ... with "sizable" economic benefits, as well as the expected ... five scientists from around the U.S. who worked on ...
... -- (July 28, 2011) -- The DNA evidence is in, ... more than 1,000 Chinese tallow trees from the United States ... the tallow trees that are overrunning thousands of acres of ... widely known that Franklin introduced tallow trees to the U.S. ...
... the Food and Drug Administration approved a drug called ... African-American patients, claiming in a press release that this ... Invention: How Science, Politics and Big Business Re-create Race ... Roberts, the Kirkland & Ellis Professor at Northwestern University ...
Cached Biology News:New study outlines economic and environmental benefits to reducing nitrogen pollution 2New study outlines economic and environmental benefits to reducing nitrogen pollution 3Genetic evidence clears Ben Franklin 2Genetic evidence clears Ben Franklin 3Divided by race 2
(Date:1/15/2014)... 15, 2014 TaiGen Biotechnology Company, Limited ("TaiGen") today ... R-Pharm, a leading Russian pharmaceutical company, to develop and ... Russian Federation , Turkey ... is a novel antibiotic for the treatment of bacterial ...
(Date:1/14/2014)... Carahsoft and CDS Federal Services have scheduled a ... EST (11am PST), “Natural Language Processing: Converting Raw Data ... can turn raw, heterogeneous data into actionable knowledge to ... webinar will last approximately one hour. , Synopsis: Big ...
(Date:1/14/2014)... , Jan. 14, 2014  3D Communications, a leading provider of strategic ... business, and media events in the United States ... associate Virginia Cox , JD, is returning to the firm,s ... Cox re-joins 3D after more than two years of service ...
(Date:1/14/2014)... 2014 EquitiesIQ, a leading informational research ... Alliqua is an emerging biomedical company acquiring, developing, manufacturing, ... market. , Free report download: http://equitiesiq.com/reports/alliqua/ , ... management team and Board, which launched the company’s new ...
Breaking Biology Technology:TaiGen Biotechnology Signed Exclusive License Agreement with R-Pharm for Nemonoxacin (Taigexyn(R)) 2TaiGen Biotechnology Signed Exclusive License Agreement with R-Pharm for Nemonoxacin (Taigexyn(R)) 3TaiGen Biotechnology Signed Exclusive License Agreement with R-Pharm for Nemonoxacin (Taigexyn(R)) 4Webcast - Natural Language Processing: Converting Raw Data into Actionable Knowledge – Hosted by Carahsoft and CDS Federal Services 2Former FDA Associate Commissioner Returns To 3D Communications 2EquitiesIQ Initiates Coverage of Alliqua, Inc. 2EquitiesIQ Initiates Coverage of Alliqua, Inc. 3