Navigation Links
Immunohistochemistry - Gene Discovery from Paragon BioServices

ProductsImmunohistochemistry - Gene Discovery from Paragon BioServices
Company Paragon BioServices
Item Immunohistochemistry - Gene Discovery
Price Inquire
Description This service involves the optimization of immunostaining. The optimization includes titration of the primary antibody, selection and optimization of secondary reagents (e.g. Alk. Phos., HRP, fluorescence, or biotinylated conjugates), optimization of detection, evaluation by light or fluorescence microscopy, and photographic documentation of positive results.
Info Paragon BioServices
Alpha Center
Baltimore, MD 21224
Customer Service: 800-545-6569
Fax Number: 410-550-2924
Web Site: http://www.paragonbiotech.com
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Histology, Immunohistochemistry & Tissue Array Services from Dominion Pharmakine S.L.
2. PCNA Immunohistochemistry Assay Kit from Invitrogen
3. BrdU Immunohistochemistry Assay Kit from Invitrogen
4. ELF® 97 Immunohistochemistry Kit from Molecular Probes (Invitrogen)
5. Imaging Mass Spectrometry for Small Molecule Localization from Protein Discovery, Inc.
6. Small Non-coding RNA Discovery Microarray - Comprehensive Service from LC Sciences
7. BD Falcon Roller Bottle, smooth surface from BD Biosciences - Discovery Labware
8. BD Falcon Roller Bottle, smooth surface from BD Biosciences - Discovery Labware
9. SkanIt Software for Varioskan, Drug Discovery Edition from Thermo Scientific
10. BD Falcon 96-well Flat-bottom ELISA Plates from BD Biosciences - Discovery Labware
11. SNP Discovery Service from Polymorphic DNA Technologies, Inc.
... Mouse monoclonal antibody raised ... Immunogen: ... 206 a.a) partial recombinant protein ... Accession Number: NM_005802 ...
Mouse monoclonal antibody raised against a full length recombinant SNAPC5. NCBI Entrez Gene ID = SNAPC5...
... monoclonal antibody raised against a partial recombinant NFKBIB. ... a.a. ~ 145 a.a) partial recombinant protein with ... EDGDTALHLAVIHQHEPFLDFLLGFSAGTEYMDLQNDLGQTALHLAAILGETSTVEKLYAAGAGLCVAERRGHTALHLACRVGAHACARA Accession: BC015528 ... OMIM: 604495, ...
... Perm/Wash Buffer I can be used in ... to permeabilize cells and to serve as ... Because saponin-mediated cell permeabilization is a reversible ... cells in the presence of saponin during ...
Biology Products:
(Date:5/23/2017)...  Hunova, the first robotic gym for the rehabilitation and functional motor ... Genoa, Italy . The first 30 robots will be ... USA . The technology was developed and patented at the ... spin-off Movendo Technology thanks to a 10 million euro investment from entrepreneur ... ...
(Date:4/19/2017)... 2017 The global military biometrics ... marked by the presence of several large global players. ... five major players - 3M Cogent, NEC Corporation, M2SYS ... nearly 61% of the global military biometric market in ... global military biometrics market boast global presence, which has ...
(Date:4/11/2017)... April 11, 2017 Crossmatch®, a globally-recognized ... solutions, today announced that it has been awarded ... Projects Activity (IARPA) to develop next-generation Presentation Attack ... "Innovation has been a driving force within ... will allow us to innovate and develop new ...
Breaking Biology News(10 mins):
(Date:8/11/2017)... ... ... Algenist continues to disrupt the skincare industry with today’s debut of GENIUS Liquid ... the key structural element skin needs to maintain its youthful appearance and Algenist is ... First to market with proprietary collagen water active , Active ...
(Date:8/10/2017)... ... August 09, 2017 , ... Teachers from three Philadelphia middle ... 14th through the 16th, the University City Science Center will kick off the ... provides Philadelphia-based middle school educators an opportunity for professional development related to STEM ...
(Date:8/10/2017)... ... August 09, 2017 , ... Okyanos Center for Regenerative Medicine has announced its ... Hotel in Freeport, Grand Bahama on September 27, 2017. This daytime event is free ... from the Ministry of Health’s National Stem Cell Ethics Committee (NSCEC) and regulations laid ...
(Date:8/10/2017)... USA, and CARDIFF, UK (PRWEB) , ... August ... ... and photonics, has announced an agreement establishing Kinokuniya Company Ltd. as its exclusive ... SPIE as the exclusive sales representative for the SPIE Digital Library in Japan. ...
Breaking Biology Technology: