Navigation Links
IHC SELECT® APR KIT SINGLE SPECIES-RAT 150 TESTS from CHEMICON

ProductsIHC SELECT® APR KIT SINGLE SPECIES-RAT 150 TESTS from CHEMICON
Company CHEMICON
Item IHC SELECT® APR KIT SINGLE SPECIES-RAT 150 TESTS
Price $250.00
Description The IHC Select Immunophosphatase Secondary Detection System is intended for use with the CHEMICON IHC Select Prediluted Primary Antibody reagents, which contain rat and goat IgG for the qualitative identification of antigens by light microscopy in paraffin-embedded tissues. The IHC Select Immunophosphatase Secondary Detection System may also be used with other rat or goat primary antibodies.

The IHC Select Immunophosphatase Secondary Detection System uses biotin-avidin- alkaline phosphatase complexed antibodies to detect rat or goat IgG in the Primary Antibody. The primary antibody binds to specific antigens present in the specimen. Any excess antibody is removed by washing. Next, the Secondary Antibody Reagent (conjugated to biotin) is added and will react with the primary antibody present on the tissue. Unbound antibody is removed by washing. The sample is then by incubated with the Streptavidin- alkaline phosphatase solution, which binds to the biotin-labeled secondary antibody present on the tissue. Unbound enzyme is removed by washing. The chromogenic development reagent, Fast Red Violet is then added and reacts with alkaline phosphatase attached to the streptavidin-biotin-antibody complex. The alkaline phosphatase activity on the chromogenic substrate results in the deposit of red insoluble precipitate at those antigenic sites containing the specific epitopes recognized by the primary antibody. Tissues processed in a variety of fixatives including neutral buffered formalin, B-5, and Bouin's may be used.
Info CHEMICONCHEMICON
CHEMICON International, Inc.
28820 Single Oak Drive
Temecula, CA 92590
Customer Service: 800-437-7500
Tech Support: 800-437-7500
Fax Number: 800-437-7502
Web Site: http://www.chemicon.com
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. IHC SELECT® DAB KIT SINGLE SPECIES-RAT 150 TESTS from CHEMICON
2. ES Cell Characterization Kit from CHEMICON
3. In Vitro Osteogenesis Assay Kit from CHEMICON
4. Human / Mouse / Rat Blood Vessels (CD31 / Von Willebrand Factor (vWF)) IHC staining Kit from CHEMICON
5. Mast Cell Degranulation colorimetric Assay Kit from CHEMICON
6. Freunds Complete Adjuvant from CHEMICON
7. Alkaline Phosphatase Detection Kit from CHEMICON
8. Vaginal Keratinocyte Progenitors, Rabbit from CHEMICON
9. Dermal Fibroblasts, Rabbit from CHEMICON
10. Normal Rabbit Tissues from CHEMICON
11. Normal Rabbit Tissues from CHEMICON
... proteins in polyacrylamide gel after SDS ... ng of protein) with *CoomassieR-G250. All ... can be performed in 1.5 hr. ... proteins can be seen before destaining. ...
Mouse monoclonal antibody raised against a partial recombinant PASK. NCBI Entrez Gene ID = PASK...
Mouse monoclonal antibody raised against a partial recombinant CRKRS. NCBI Entrez Gene ID = CRKRS...
... raised against a partial recombinant FES. ... a.a. ~ 250 a.a) partial recombinant protein ... Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA Accession: ... Number: AAH35357 OMIM: ...
Biology Products:
(Date:3/30/2017)... ANGELES , March 30, 2017  On April ... Hack the Genome hackathon at Microsoft,s ... exciting two-day competition will focus on developing health and ... Hack the Genome is the ... been tremendous. The world,s largest companies in the genomics, ...
(Date:3/28/2017)... India , March 28, 2017 ... IP, Biometrics), Hardware (Camera, Monitors, Servers, Storage Devices), Software ... Vertical, and Region - Global Forecast to 2022", published ... Billion in 2016 and is projected to reach USD ... between 2017 and 2022. The base year considered for ...
(Date:3/23/2017)... The report "Gesture Recognition and Touchless Sensing Market by ... Global Forecast to 2022", published by MarketsandMarkets, the market is expected to be ... 2017 and 2022. Continue Reading ... ... ...
Breaking Biology News(10 mins):
(Date:10/12/2017)... , ... October 12, 2017 , ... ... Vilnius, Lithuania, announced today that they have entered into a multiyear collaboration to ... provide CRISPR researchers with additional tools for gene editing across all applications. , ...
(Date:10/12/2017)... ... 12, 2017 , ... AMRI, a global contract research, development ... patient outcomes and quality of life, will now be offering its impurity solutions ... new regulatory requirements for all new drug products, including the finalization of ICH ...
(Date:10/11/2017)... ... October 11, 2017 , ... The CRISPR-Cas9 system ... experiments and avoiding the use of exogenous expression plasmids. The simplicity of programming ... systematic gain-of-function studies. , This complement to loss-of-function studies, such as with ...
(Date:10/11/2017)... , ... October 11, 2017 , ... ... announced today it will be hosting a Webinar titled, “Pathology is going digital. ... Associates , on digital pathology adoption best practices and how Proscia improves lab ...
Breaking Biology Technology: