Navigation Links
Hybridoma Storage from AbD Serotec

ProductsHybridoma Storage from AbD Serotec
Company AbD Serotec
Item Hybridoma Storage
Price $360.00
Description Perhaps sheer in-house demand is causing shortages in your laboratory or fellow researchers want your precious antibody. This can cause unwanted distractions, problems and delays. • Receive royalties for your hard work and endeavour! Bring us your idea and let us build it up and market it internationally. We work under ISO 9001 quality assurance in design, development, production, installation and servicing. • Reliable reproducibility of your experiments requires consistent, high quality antibodies. We can guarantee this! Choose from a wide choice of enzymes, fluorochromes and biotin e.g. FITC, TRITC, RPE, APC, BIOTIN, HRP, AP and our new Alexa Fluor dyes.

  • Format: Storage
  • Product Type: Custom Production Service - Storage
Info AbD SerotecAbD Serotec

UK & Ireland
MorphoSys UK Ltd
Endeavour House
Langford Business Park
Langford Lane
Kidlington
Oxford, OX5 1GF, UK
Tel: +44(0)1865 852 700
Fax: +44(0)1865 852 739
E-mail: sales@ab-direct.com

North & South America
MorphoSys US Inc
3200 Atlantic Avenue, Suite 125
Raleigh, NC 27604, USA
Toll Free: 1-800-265-7376
Tel: 919-878-7978
Fax: 919-878-3751
E-mail: sales.us@ab-direct.com

Scandinavia & Baltic States
MorphoSys UK Ltd (Scandinavia)
Postboks 4079
N-2306 HAMAR, Norway
Tel: +44 (0)1865 852 728
Fax: +44 (0)1865 852 739
E-mail: sales.no@ab-direct.com

France & Belgium
MorphoSys UK Ltd (France)
15 rue des Pas Perdus
BP 38338
95804 Cergy Saint-Christophe
France
Tel: + 33 1 34 25 83 34
Fax: + 33 1 34 25 44 00
E-mail: sales.fr@ab-direct.com

Germany, Netherlands, Austria & Switzerland
MorphoSys AbD GmbH
Immermannstr. 13
D-40210 Dsseldorf
Germany
Tel (General): +49 (0)211 93 503 10
Tel (Technical): +49 (0)211 93 503 11
Fax: +49 (0)211 93 503 12
E-mail: sales.de@ab-direct.com

Worldwide
MorphoSys UK Ltd
Endeavour House
Langford Business Park
Langford Lane
Kidlington
Oxford, OX5 1GF, UK
Tel: +44(0)1865 852 700
Fax: +44(0)1865 852 739
E-mail: sales@ab-direct.com

Customer Service: 1-800-265-7376
Fax Number: 1-919-878-3751
Web Site: www.ab-direct.com
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Hybridoma Development from QED Bioscience Inc.
2. Mouse Anti-Xenopus laevis Xenopus nuclear factor Antibody, Unconjugated from Developmental Studies Hybridoma Bank
3. Mouse Anti-Drosophila Quail Monoclonal Antibody, Unconjugated from Developmental Studies Hybridoma Bank
4. Mouse Anti-Drosophila Yan Drosophila protein Antibody, Unconjugated from Developmental Studies Hybridoma Bank
5. Mouse Anti-Xenopus laevis Xenopus nuclear factor, xnf7 Antibody, Unconjugated from Developmental Studies Hybridoma Bank
6. Mouse Anti-Quail cell marker Antibody, Unconjugated from Developmental Studies Hybridoma Bank
7. Mouse Anti-Human VCAM-1 Monoclonal Antibody, Unconjugated from Developmental Studies Hybridoma Bank
8. Mouse Anti-Drosophila Melanogaster Achaete protein Monoclonal Antibody, Unconjugated from Developmental Studies Hybridoma Bank
9. Mouse Anti-Drosophila fasciclin III Monoclonal Antibody, Unconjugated from Developmental Studies Hybridoma Bank
10. Hybridoma Development from Covance Research Products, Inc
11. Mouse Anti-Human huntingtin Monoclonal Antibody, Unconjugated from Developmental Studies Hybridoma Bank
... Mouse monoclonal antibody raised ... Immunogen: ... 206 a.a) partial recombinant protein ... Accession Number: NM_005802 ...
Mouse monoclonal antibody raised against a full length recombinant SNAPC5. NCBI Entrez Gene ID = SNAPC5...
... monoclonal antibody raised against a partial recombinant NFKBIB. ... a.a. ~ 145 a.a) partial recombinant protein with ... EDGDTALHLAVIHQHEPFLDFLLGFSAGTEYMDLQNDLGQTALHLAAILGETSTVEKLYAAGAGLCVAERRGHTALHLACRVGAHACARA Accession: BC015528 ... OMIM: 604495, ...
... Perm/Wash Buffer I can be used in ... to permeabilize cells and to serve as ... Because saponin-mediated cell permeabilization is a reversible ... cells in the presence of saponin during ...
Biology Products:
(Date:5/23/2017)...  Hunova, the first robotic gym for the rehabilitation and functional motor ... Genoa, Italy . The first 30 robots will be ... USA . The technology was developed and patented at the ... spin-off Movendo Technology thanks to a 10 million euro investment from entrepreneur ... ...
(Date:4/19/2017)... 2017 The global military biometrics ... marked by the presence of several large global players. ... five major players - 3M Cogent, NEC Corporation, M2SYS ... nearly 61% of the global military biometric market in ... global military biometrics market boast global presence, which has ...
(Date:4/11/2017)... April 11, 2017 Crossmatch®, a globally-recognized ... solutions, today announced that it has been awarded ... Projects Activity (IARPA) to develop next-generation Presentation Attack ... "Innovation has been a driving force within ... will allow us to innovate and develop new ...
Breaking Biology News(10 mins):
(Date:8/11/2017)... ... ... Algenist continues to disrupt the skincare industry with today’s debut of GENIUS Liquid ... the key structural element skin needs to maintain its youthful appearance and Algenist is ... First to market with proprietary collagen water active , Active ...
(Date:8/10/2017)... ... August 09, 2017 , ... Teachers from three Philadelphia middle ... 14th through the 16th, the University City Science Center will kick off the ... provides Philadelphia-based middle school educators an opportunity for professional development related to STEM ...
(Date:8/10/2017)... ... August 09, 2017 , ... Okyanos Center for Regenerative Medicine has announced its ... Hotel in Freeport, Grand Bahama on September 27, 2017. This daytime event is free ... from the Ministry of Health’s National Stem Cell Ethics Committee (NSCEC) and regulations laid ...
(Date:8/10/2017)... USA, and CARDIFF, UK (PRWEB) , ... August ... ... and photonics, has announced an agreement establishing Kinokuniya Company Ltd. as its exclusive ... SPIE as the exclusive sales representative for the SPIE Digital Library in Japan. ...
Breaking Biology Technology: