Navigation Links
Hybridoma Development from Covance Research Products, Inc

ProductsHybridoma Development from Covance Research Products, Inc
Company Covance Research Products, Inc
Item Hybridoma Development
Price $239.00
Description Covance has generated hybridomas against a large variety of antigens. Prior to project initiation, you are provided with personalized project proposals and strategy consultation. Hybridoma cell lines developed by Covance remain exclusive property of the client. A typical hybridoma development project has four phases: immunization, fusion, cloning and hybridoma stabilization. Any aspect of these four phases can be customized to meet your needs. The investigator has the option to terminate hybridoma development projects prior to the beginning of any phase. If desired, projects can be transferred to you at any point to give unparalleled control over your project.

Quality
ISO 9001:2000 Certified
USDA Research Registered
OLAW Assured
AAALAC Accredited
All Precedures Validated, SOP's

Training
AALAS Certified Technicians

Documentation
GLP Process for All Procedures
GLP Documentation Upon Request

Facilities
100% Fresh Air, Custom Animal Barrier Facility
Shower-in Barrier for All
Independent Water and HVAC in All Animal Rooms
24/7 Monitored Operations with Security Systems

Focus
CRP is your one stop shopping point for all your custom immunology service needs. We offer free project consultation, free peptide sequence recommendation, peptide synthesis and conjugation, polyclonal antibody production (rodents, guinea pigs, rabbits, chickens, goat, sheep, and more), hybridoma development, monoclonal antibody production (in-vitro and in-vivo), serum, ascites, and spent media purification, antibody labeling, and custom packaging and shipping.

A choice of up to 48 +clones, 3rd generation clone/cell line provided, customization options available, client owns cell line.

Host Species: SPF Balb/c Mouse or SPF Sprague Dawley Rat

Info Covance Research Products, IncCovance Research Products, Inc
P.O. Box 7200
Denver, Pennsylvania 17517

Customer Service:
800-345-4114 (Toll Free)
717-336-4921

Fax Number:
717-336-5344

Web Site: http://www.crpinc.com
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Hybridoma Development from QED Bioscience Inc.
2. Mouse Anti-Xenopus laevis Xenopus nuclear factor Antibody, Unconjugated from Developmental Studies Hybridoma Bank
3. Hybridoma Storage from AbD Serotec
4. Mouse Anti-Drosophila Quail Monoclonal Antibody, Unconjugated from Developmental Studies Hybridoma Bank
5. Mouse Anti-Drosophila Yan Drosophila protein Antibody, Unconjugated from Developmental Studies Hybridoma Bank
6. Mouse Anti-Xenopus laevis Xenopus nuclear factor, xnf7 Antibody, Unconjugated from Developmental Studies Hybridoma Bank
7. Mouse Anti-Quail cell marker Antibody, Unconjugated from Developmental Studies Hybridoma Bank
8. Mouse Anti-Human VCAM-1 Monoclonal Antibody, Unconjugated from Developmental Studies Hybridoma Bank
9. Mouse Anti-Drosophila Melanogaster Achaete protein Monoclonal Antibody, Unconjugated from Developmental Studies Hybridoma Bank
10. Mouse Anti-Drosophila fasciclin III Monoclonal Antibody, Unconjugated from Developmental Studies Hybridoma Bank
11. Mouse Anti-Human huntingtin Monoclonal Antibody, Unconjugated from Developmental Studies Hybridoma Bank
Mouse monoclonal antibody raised against a partial recombinant DENR. NCBI Entrez Gene ID = DENR...
Mouse monoclonal antibody raised against a partial recombinant IL31RA. NCBI Entrez Gene ID = IL31RA...
... monoclonal antibody raised against a partial recombinant NFKBIB. ... a.a. ~ 145 a.a) partial recombinant protein with ... EDGDTALHLAVIHQHEPFLDFLLGFSAGTEYMDLQNDLGQTALHLAAILGETSTVEKLYAAGAGLCVAERRGHTALHLACRVGAHACARA Accession: BC015528 ... OMIM: 604495, ...
... Mouse polyclonal antibody raised against a partial ... FES (AAH35357, 120 a.a. ~ 250 a.a) ... Protein Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA ... Protein Accession Number: AAH35357 ...
Biology Products:
(Date:9/23/2014)... the development of animals and plants. The central problem ... translated in a reliable manner to give specific spatial ... of stripe formation is a classic paradigm in developmental ... the French flag, is caused by a gradient of ... low concentrations of the morphogen a "blue", "white" or ...
(Date:9/23/2014)... SPRINGS, Florida , September 23, 2014 ... for innovative companies in tech sector position for significant investor ... products & services.  Companies in focus today are: NXT-ID, Inc. ... BABA ), Mobileye N.V. (NYSE: MBLY ... Robotics Ltd. (NASDAQ: RWLK) NXT-ID, Inc. (NASDAQ: ...
(Date:9/22/2014)... Many native species have vanished from tropical islands ... scientists have discovered how fossils can be used ... lies in organic materials found in fossil bones, ... according to a new study available online and ... of Herpetology . Pre-human island ecosystems provide vital ...
Breaking Biology News(10 mins):Recreating the stripe patterns found in animals by engineering synthetic gene networks 2Latest Blockbuster IPOs and Up Listings for Global Tech Stocks Attracting Major Attention as Traders Focus on Key Economic Data Due this Week 2Latest Blockbuster IPOs and Up Listings for Global Tech Stocks Attracting Major Attention as Traders Focus on Key Economic Data Due this Week 3Latest Blockbuster IPOs and Up Listings for Global Tech Stocks Attracting Major Attention as Traders Focus on Key Economic Data Due this Week 4Latest Blockbuster IPOs and Up Listings for Global Tech Stocks Attracting Major Attention as Traders Focus on Key Economic Data Due this Week 5Latest Blockbuster IPOs and Up Listings for Global Tech Stocks Attracting Major Attention as Traders Focus on Key Economic Data Due this Week 6Latest Blockbuster IPOs and Up Listings for Global Tech Stocks Attracting Major Attention as Traders Focus on Key Economic Data Due this Week 7Answer to restoring lost island biodiversity found in fossils 2
... , HERNDON, Va., Dec. 15 The PTR ... announced that it has agreed to sponsor three high school teams ... http://usfirst.org ). , The PTR Group will provide funding ... teams from Atholton HS in Columbia, MD, Rockwall HS in Rockwall, ...
... often promoted as a clean-burning, renewable fuel that could help ... caused by ozone, compared with gasoline, especially in winter, according ... Ozone production from both gasoline and E85, a blend of ... in warm sunny weather than during the cold weather and ...
... 10, 2009If you are spending the holidays with big Uncle ... be better off with another family, spare a thought for ... McMaster University and the University of New South Wales has ... members make strategic decisions about their living situation. ...
Cached Biology News:The PTR Group Announces Financial and Technical Support to US FIRST Robotics Competition Teams 2Ethanol-powered vehicles generate more ozone than gas-powered ones 2Ethanol-powered vehicles generate more ozone than gas-powered ones 3
(Date:9/23/2014)... 23, 2014 Texas Fertility Center (TFC) ... South Austin, expanding a Central Texas footprint that includes ... The satellite office for the region’s most established practice ... the South Austin, Buda, Kyle and San Marcos communities. ... fertility treatment directly to individuals and couples living in ...
(Date:9/23/2014)... (PRWEB) September 23, 2014 The ... a developer of cellular modems , platforms ... in the Startup category for the 2014 Tekne ... held at the Minneapolis Convention Center on Thursday, ... and individuals who have shown superior technology innovation ...
(Date:9/22/2014)... YORK and SANTA CLARA, Calif. ... Corp. (NASDAQ: WBMD ), the leading source ... new WebMD/Medscape survey that provide novel insights ... in aiding diagnosis and care.  Dr. Eric Topol ... and digital medicine, who serves as both Editor-in-Chief of ...
(Date:9/22/2014)... in a mouse model of pancreatic cancer identified distinct ... including significant differences from the primary tumor that may ... their study reported in the Sept. 25 issue of ... Hospital (MGH) Cancer Center identified several different classes of ... to be targets for improved treatment of the deadly ...
Breaking Biology Technology:Opening Doors to a Family: Texas Fertility Center Announces Newest Fertility Clinic in South Austin 2Opening Doors to a Family: Texas Fertility Center Announces Newest Fertility Clinic in South Austin 3NimbeLink Named Finalist for 15th Annual Tekne Awards 2NimbeLink Named Finalist for 15th Annual Tekne Awards 3WebMD/Medscape Digital Technology Survey Reveals Unique Insights Into How Patients and Physicians Perceive the Role, Potential and Risks Associated with Digital Health Technologies 2WebMD/Medscape Digital Technology Survey Reveals Unique Insights Into How Patients and Physicians Perceive the Role, Potential and Risks Associated with Digital Health Technologies 3WebMD/Medscape Digital Technology Survey Reveals Unique Insights Into How Patients and Physicians Perceive the Role, Potential and Risks Associated with Digital Health Technologies 4Massachusetts General study reveals gene expression patterns in pancreatic CTCs 2Massachusetts General study reveals gene expression patterns in pancreatic CTCs 3