Navigation Links
Hybridoma Development from Covance Research Products, Inc

ProductsHybridoma Development from Covance Research Products, Inc
Company Covance Research Products, Inc
Item Hybridoma Development
Price $239.00
Description Covance has generated hybridomas against a large variety of antigens. Prior to project initiation, you are provided with personalized project proposals and strategy consultation. Hybridoma cell lines developed by Covance remain exclusive property of the client. A typical hybridoma development project has four phases: immunization, fusion, cloning and hybridoma stabilization. Any aspect of these four phases can be customized to meet your needs. The investigator has the option to terminate hybridoma development projects prior to the beginning of any phase. If desired, projects can be transferred to you at any point to give unparalleled control over your project.

Quality
ISO 9001:2000 Certified
USDA Research Registered
OLAW Assured
AAALAC Accredited
All Precedures Validated, SOP's

Training
AALAS Certified Technicians

Documentation
GLP Process for All Procedures
GLP Documentation Upon Request

Facilities
100% Fresh Air, Custom Animal Barrier Facility
Shower-in Barrier for All
Independent Water and HVAC in All Animal Rooms
24/7 Monitored Operations with Security Systems

Focus
CRP is your one stop shopping point for all your custom immunology service needs. We offer free project consultation, free peptide sequence recommendation, peptide synthesis and conjugation, polyclonal antibody production (rodents, guinea pigs, rabbits, chickens, goat, sheep, and more), hybridoma development, monoclonal antibody production (in-vitro and in-vivo), serum, ascites, and spent media purification, antibody labeling, and custom packaging and shipping.

A choice of up to 48 +clones, 3rd generation clone/cell line provided, customization options available, client owns cell line.

Host Species: SPF Balb/c Mouse or SPF Sprague Dawley Rat

Info Covance Research Products, IncCovance Research Products, Inc
P.O. Box 7200
Denver, Pennsylvania 17517

Customer Service:
800-345-4114 (Toll Free)
717-336-4921

Fax Number:
717-336-5344

Web Site: http://www.crpinc.com
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Hybridoma Development from QED Bioscience Inc.
2. Mouse Anti-Xenopus laevis Xenopus nuclear factor Antibody, Unconjugated from Developmental Studies Hybridoma Bank
3. Hybridoma Storage from AbD Serotec
4. Mouse Anti-Drosophila Quail Monoclonal Antibody, Unconjugated from Developmental Studies Hybridoma Bank
5. Mouse Anti-Drosophila Yan Drosophila protein Antibody, Unconjugated from Developmental Studies Hybridoma Bank
6. Mouse Anti-Xenopus laevis Xenopus nuclear factor, xnf7 Antibody, Unconjugated from Developmental Studies Hybridoma Bank
7. Mouse Anti-Quail cell marker Antibody, Unconjugated from Developmental Studies Hybridoma Bank
8. Mouse Anti-Human VCAM-1 Monoclonal Antibody, Unconjugated from Developmental Studies Hybridoma Bank
9. Mouse Anti-Drosophila Melanogaster Achaete protein Monoclonal Antibody, Unconjugated from Developmental Studies Hybridoma Bank
10. Mouse Anti-Drosophila fasciclin III Monoclonal Antibody, Unconjugated from Developmental Studies Hybridoma Bank
11. Mouse Anti-Human huntingtin Monoclonal Antibody, Unconjugated from Developmental Studies Hybridoma Bank
Mouse monoclonal antibody raised against a partial recombinant IL31RA. NCBI Entrez Gene ID = IL31RA...
... a partial recombinant NFKBIB. Immunogen: ... partial recombinant protein with GST tag. ... Accession: BC015528 Protein Accession ... 604495, GeneID: 4793 ...
... a partial recombinant FES. ... 250 a.a) partial recombinant protein with GST ... WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA Accession: BC035357 ... AAH35357 OMIM: 190030, ...
Mouse polyclonal antibody raised against a partial recombinant PREB. NCBI Entrez Gene ID = 10113...
Biology Products:
(Date:7/20/2017)... , July 20, 2017 Delta (NYSE: DAL ... board any Delta aircraft at Reagan Washington National Airport (DCA). ... Delta launches biometrics to ... Delta,s biometric ... Sky Club is now integrated into the boarding process to allow ...
(Date:5/16/2017)... 2017  Veratad Technologies, LLC ( www.veratad.com ), an ... identity verification solutions, announced today they will participate as ... 15 thru May 17, 2017, in Washington ... Center. Identity impacts the lives of ... quickly evolving digital world, defining identity is critical to ...
(Date:4/18/2017)... Inc., a global expert in SoC-based imaging and computing solutions, has ... features the company,s hybrid codec technology. A demonstration utilizing TeraFaces ® ... be showcased during the upcoming Medtec Japan at Tokyo Big Sight ... Las Vegas Convention Center April 24-27. ... Click here for an image of the ...
Breaking Biology News(10 mins):
(Date:10/12/2017)... ... ... AMRI, a global contract research, development and manufacturing organization ... quality of life, will now be offering its impurity solutions as a stand-alone ... for all new drug products, including the finalization of ICH M7 earlier this ...
(Date:10/11/2017)... USA (PRWEB) , ... October 11, 2017 , ... ComplianceOnline’s ... take place on 7th and 8th June 2018 in San Francisco, CA. The Summit ... as well as several distinguished CEOs, board directors and government officials from around the ...
(Date:10/11/2017)... ... October 11, 2017 , ... A new study published ... frozen and fresh in vitro fertilization (IVF) transfer cycles. The multi-center ... success. , After comparing the results from the fresh and frozen transfer cohorts, ...
(Date:10/10/2017)... ... ... Dr. Bob Harman, founder and CEO of VetStem Biopharma, Inc. spent ... entitled “Stem Cells and Their Regenerative Powers,” was held on August 31st, 2017 ... joined by two human doctors: Peter B. Hanson, M.D., Chief of Orthopedic Surgery, Grossmont ...
Breaking Biology Technology: