Navigation Links
Hybridization Chamber from Aviva Systems Biology

ProductsHybridization Chamber from Aviva Systems Biology
Company Aviva Systems Biology
Item Hybridization Chamber
Price $160.00
Description Hybridization chamblers suitable for use with all ChIP-GLAS microarrays.
Info Aviva Systems Biology
11180 Roselle St, Suite 300
San Diego, CA 92121
Customer Service:
858-552-6979
888-880-0001 (Toll Free)

Fax Number:
858-552-6975

Web Site: http://www.avivasysbio.com/
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. a-Hyb Hybridization Station from Miltenyi Biotec
2. Hybridization chamber with forced convection BFD 53 from BINDER
3. SlideHyb Glass Array Hybridization Buffer #1 from Ambion
4. Microarray Gasket Slide Kit for Hybridization Chamber - SureHyb enabled (11K ) from Agilent Technologies
5. SlideHyb Glass Array Hybridization Buffer #1 from Ambion
6. Hybridization module, Hypro20 from Thermo Scientific
7. Hybridization module,Hypro100 from Thermo Scientific
8. Maxi XL Hybridization Oven from Thermo Scientific
9. Maxi 14 Hybridization Oven from Thermo Scientific
10. Hybridization Cassettes from Caliper Life Sciences
11. HS 4800 Hybridization Station from Tecan
... Lines ,High Quality, Functionally-Validated, Ion Channel Cell ... for having a critical role in nerve ... key function in pain, CNS and the ... been investigated in therapeutic areas, such as ...
Mouse monoclonal antibody raised against a partial recombinant CHD8. NCBI Entrez Gene ID = CHD8...
Mouse monoclonal antibody raised against a partial recombinant PASK. NCBI Entrez Gene ID = PASK...
... Mouse monoclonal antibody raised against a partial recombinant ... 56 a.a. ~ 145 a.a) partial recombinant protein ... EDGDTALHLAVIHQHEPFLDFLLGFSAGTEYMDLQNDLGQTALHLAAILGETSTVEKLYAAGAGLCVAERRGHTALHLACRVGAHACARA Accession: BC015528 ... OMIM: 604495, ...
Biology Products:
(Date:4/11/2017)... -- NXT-ID, Inc. (NASDAQ:   NXTD ) ("NXT-ID" ... of independent Directors Mr. Robin D. Richards and ... furthering the company,s corporate governance and expertise. ... Gino Pereira , Chief Executive Officer ... guidance and benefiting from their considerable expertise as we move ...
(Date:4/4/2017)... , April 4, 2017   EyeLock LLC , ... that the United States Patent and Trademark Office (USPTO) ... covers the linking of an iris image with a ... and represents the company,s 45 th issued patent. ... is very timely given the multi-modal biometric capabilities that ...
(Date:3/29/2017)... March 29, 2017  higi, the health IT company ... North America , today announced a Series ... acquisition of EveryMove. The new investment and acquisition accelerates ... tools to transform population health activities through the collection ... higi collects and secures data today on ...
Breaking Biology News(10 mins):
(Date:10/12/2017)... ... October 12, 2017 , ... ... genomics analysis platform specifically designed for life science researchers to analyze and ... researcher Rosalind Franklin, who made a major contribution to the discovery of ...
(Date:10/11/2017)... ... October 11, 2017 , ... Personal eye wash is a basic first aid supply for any ... So which eye do you rinse first if a dangerous substance enters both eyes? It’s ... Wash with its unique dual eye piece. , “Whether its dirt and debris, or ...
(Date:10/11/2017)... BioMarketing, a leading provider of patient support solutions, has announced ... network, which will launch this week. The VMS CNEs will ... to enhance the patient care experience by delivering peer-to-peer education ... professionals to help women who have been diagnosed and are ... ...
(Date:10/11/2017)... ... 11, 2017 , ... A new study published in Fertility ... fresh in vitro fertilization (IVF) transfer cycles. The multi-center matched cohort ... After comparing the results from the fresh and frozen transfer cohorts, the authors ...
Breaking Biology Technology: