Navigation Links
HybriWell™ hybridization sealing system, 22 mm x 22 mm chamber, 0.15 mm deep *set of 100* from Molecular Probes (Invitrogen)

ProductsHybriWell™ hybridization sealing system, 22 mm x 22 mm chamber, 0.15 mm deep *set of 100* from Molecular Probes (Invitrogen)
Company Molecular Probes (Invitrogen)
Item HybriWell™ hybridization sealing system, 22 mm x 22 mm chamber, 0.15 mm deep *set of 100*
Price 
Description HybriWell™ hybridization sealing system, 22 mm x 22 mm chamber, 0.15 mm deep *set of 100*
Info Molecular Probes (Invitrogen)Molecular Probes (Invitrogen)
PO Box 22010
Eugene, OR 97402-0469

Call Molecular Probes (Invitrogen) to buy products (US and Canada only; other locations use numbers below)
USA Canada 1-541-359-2658
Customer Service: 1-541-465-8300
Fax Number: 1-541-344-6504
Web Site: http://probes.invitrogen.com
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Adhesive seal-tab, for HybriWell™ hybridization sealing system *set of 400* from Molecular Probes (Invitrogen)
2. HybriWell™ hybridization sealing system, 20 mm diameter chamber, 0.15 mm deep *set of 100* from Molecular Probes (Invitrogen)
3. HybArray 12 DNA hybridization system from PerkinElmer
4. Agilent Microarray hybridization Chamber Kits from Agilent Technologies
5. Techne hybridization oven HB-1D from Sigma-Aldrich
6. Techne hybridization oven Hybrigene from Sigma-Aldrich
7. Secure-Seal hybridization chambers from Sigma-Aldrich
8. Modular hybridization system from Sigma-Aldrich
9. Modular hybridization system from Sigma-Aldrich
10. Secure-Seal hybridization chambers from Sigma-Aldrich
11. Techne hybridization oven accessories from Sigma-Aldrich
Agarose II (Low Melt)...
... monoclonal antibody raised against a partial recombinant NFKBIB. ... a.a. ~ 145 a.a) partial recombinant protein with ... EDGDTALHLAVIHQHEPFLDFLLGFSAGTEYMDLQNDLGQTALHLAAILGETSTVEKLYAAGAGLCVAERRGHTALHLACRVGAHACARA Accession: BC015528 ... OMIM: 604495, ...
Mouse monoclonal antibody raised against a partial recombinant CRKRS. NCBI Entrez Gene ID = CRKRS...
... The BD PhosFlow Perm/Wash Buffer I can ... modified signaling proteins to permeabilize cells and ... cell wash buffer. Because saponin-mediated cell permeabilization ... to keep the cells in the presence ...
Biology Products:
(Date:2/16/2017)... 2017  Genos, a community for personal genetic ... received Laboratory Accreditation from the College of American ... laboratories that meet stringent requirements around quality, accuracy ... "Genos is committed to maintaining the ... honored to be receiving CAP accreditation," said ...
(Date:2/10/2017)... , Feb 10, 2017 Research ... report "Personalized Medicine - Scientific and Commercial Aspects" ... ... medicine. Diagnosis is integrated with therapy for selection of treatment ... early detection and prevention of disease in modern medicine. Biochip/microarray ...
(Date:2/8/2017)... Feb. 7, 2017 Report Highlights ... The global synthetic-biology market ... billion by 2021, growing at a compound annual growth rate ... overview of the global markets for synthetic biology. - Analyses ... 2016, and projections of compound annual growth rates (CAGRs) through ...
Breaking Biology News(10 mins):
(Date:2/23/2017)... TORONTO , Feb. 23, 2017 /PRNewswire/ - The ... Institute for Cancer Research (OICR) are pleased to report ... Series A financing, with Johnson & Johnson Innovation – ... investors include venture groups HealthCap, TPG Biotechnology Partners, and ... ...
(Date:2/23/2017)... Antonio, TX (PRWEB) , ... February 23, 2017 ... ... Drug Administration (FDA) de novo clearance to begin marketing the SPEAC® System, the ... indicated for adults at home or in healthcare facilities during periods of rest. ...
(Date:2/23/2017)... Feb. 23, 2017  Capricor Therapeutics, Inc. (NASDAQ: CAPR), a ... conditions, today announced that Linda Marbán, Ph.D, president and chief ... conferences: Cowen and Company 37th Annual ... ET Boston, MA ... am PT (12:00 pm ET) Dana Point, CA ...
(Date:2/22/2017)... ... February 22, 2017 , ... Kernel ... Kendall Research Systems, LLC (KRS) clinical development program. KRS is a neurotechnology ... for research and clinical applications. The terms of the transaction were not disclosed. ...
Breaking Biology Technology: