Navigation Links
Human Serum (All Male Donors) from Irvine Scientific

ProductsHuman Serum (All Male Donors) from Irvine Scientific
Company Irvine Scientific
Item Human Serum (All Male Donors)
Price Inquire
Description sterile filtered, off the clot, all male donors, Total Protein: 4.5 to 8.5 g/dl
Info Irvine ScientificIrvine Scientific
Irvine Scientific
2511 Daimler St.
Santa Ana, CA 92705-5588
Customer Service: 800-577-6097
Tech Support: 800-437-5706
Fax Number: 949-261-6522
Web Site: http://www.irvinesci.com
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Mouse Anti-Human S-100 alpha/beta chain Monoclonal Antibody, Unconjugated, Clone 8B10 from Santa Cruz Biotechnology, Inc.
2. Rabbit Anti-Human Vitamin K-dependent Protein S (PROS1) Polyclonal Antibody, Unconjugated from Lifespan Biosciences
3. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Human Placenta from OriGene Technologies
4. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Human Heart from OriGene Technologies
5. Mouse Anti-Human Complement factor B Monoclonal Antibody, Unconjugated, Clone 9B6 from AntibodyShop A/S
6. Mouse Anti-Human Choriongonadotropin (hCG) Monoclonal Antibody, Unconjugated, Clone 5F10 from AntibodyShop A/S
7. Mouse Anti-Human Procollagen type I C-terminal propeptide (PICP) Monoclonal Antibody, Unconjugated from AntibodyShop A/S
8. Mouse Anti-Human Acetylcholinesterase, brain (AChE) Monoclonal Antibody, Unconjugated, Clone 12B4 from AntibodyShop A/S
9. Mouse Anti-Human a1-Antitrypsin (alpha-1 AT) Monoclonal Antibody, Unconjugated, Clone 4E5 from AntibodyShop A/S
10. pMIR-hU6-Luc, Human U6 Luciferase Control Vector from Mirus Bio Corporation
11. Human and Mouse RAR Neutralizing Peptide from ABR-Affinity BioReagents
Mouse monoclonal antibody raised against a partial recombinant CRKRS. NCBI Entrez Gene ID = CRKRS...
... Mouse polyclonal antibody raised against a ... FES (AAH35357, 120 a.a. ~ 250 ... Protein Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA ... Protein Accession Number: AAH35357 ...
... antibody raised against a partial ... Immunogen: PPP4C (NP_002711, 218 ... recombinant protein with GST tag. ... NM_002720 ...
Mouse monoclonal antibody raised against a partial recombinant CAPG. NCBI Entrez Gene ID = CAPG...
Biology Products:
(Date:11/24/2016)... Nov. 23, 2016 Cercacor today introduced Ember ... their trainers non-invasively measure hemoglobin, Oxygen Content, ... and Respiration Rate in approximately 30 seconds. Smaller than ... and immediate access to key data about their bodies ... training regimen. Hemoglobin carries oxygen to ...
(Date:11/21/2016)... VILNIUS, Lithuania , Nov. 21, 2016 /PRNewswire/ ... identification and object recognition technologies, today announced that ... for smart cards was submitted for the ... and successfully passed all the mandatory steps of ... III evaluation is a continuing test of fingerprint ...
(Date:11/17/2016)... 17, 2016  AIC announces that it has just released a new white paper ... high-performance scale-out plus high speed data transfer storage solutions. Photo - ... ... ... Setting up a high performance computing or HPC ...
Breaking Biology News(10 mins):
(Date:11/30/2016)... , Nov. 30, 2016 /PRNewswire/ - Portage Biotech Inc. ... Exchange: PBT.U), is excited to announce the formation ... on developing preclinical ophthalmology assets through proof of ... anti-inflammatory created by Portage Pharmaceuticals Limited and being ... ocular surface and anterior segment diseases. This agent ...
(Date:11/30/2016)...  Tempus, a technology company focused on supporting ... Cancer Center have partnered to better determine which ... treatment based on next generation genomic and transcriptomic ... research collaboration, Tempus will provide sequencing and analysis ... to Penn. Utilizing next-generation sequencing, machine learning and ...
(Date:11/30/2016)... --  Merck , a leading science and technology company, ... of agreements with Evotec AG, whereby Evotec AG will ... such as CRISPR and shRNA libraries. Combining access to ... pathway to explore and identify new drug targets. ... targets, a process that can be time- and labor-intensive," ...
(Date:11/30/2016)... Park, North Carolina (PRWEB) , ... November 30, 2016 , ... ... approved the names and symbols for four elements: nihonium (Nh), moscovium (Mc), tennessine ... a 5-month period of public review, the names earlier proposed by the discoverers have ...
Breaking Biology Technology: