Navigation Links
HERAcell 150 and 240 from Thermo Scientific

ProductsHERAcell 150 and 240 from Thermo Scientific
Company Thermo Scientific
Item HERAcell 150 and 240
Description The Heraeus HERAcell is the ideal CO2 incubator for cell and tissue cultures, including development of ova or embryos at or near body temperature. HERAcell incubators are specifically designed to provide everything needed to protect and grow your valuable samples:

Safe and stable incubation conditions ensure optimum culture growth.
ContraCon 90 C decontamination routine decontaminates the entire chamber interior and is proven to eliminate mycoplasma.
Air jacket maintains temperature uniformity and quick set-up time.
Direct humidification offers the fastest humidity recovery times and provides optimal growth conditions for cultures.
Available in copper or stainless steel.
All HERAcell incubators are also available with optional Trigas-O2-control for hyperoxic applications.
Info Thermo ScientificThermo Scientific
450 Fortune Blvd.
Milford, MA 01757
Customer Service: North America: 1-877-THERMO-U
Fax Number: 508-520-2229
Web Site:
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Thermo Sequenase Dye Primer Manual Cycle Sequencing Kit from USB Corp.
2. Finnigan Pocket Surveyor from Thermo Scientific
3. DSQ II Single Quadrupole GC/MS from Thermo Scientific
4. LXQ High Throughput Linear Ion Trap from Thermo Scientific
5. LTQ XL Linear Ion Trap from Thermo Scientific
6. Thermo-Fast 96 PCR Plate, Non-Skirted from ABgene
7. ChromQuest is a powerful and flexible Chromatography Data System (CDS) from Thermo Scientific
8. Thermostable dUTPase from GenScript Corporation
9. TSQ Quantum Ultra from Thermo Scientific
10. LTQ XL with ETD from Thermo Scientific
11. Wellwash 4 Mk 2 from Thermo Scientific
... Mouse monoclonal antibody raised ... Immunogen: ... 206 a.a) partial recombinant protein ... Accession Number: NM_005802 ...
Mouse monoclonal antibody raised against a full length recombinant SNAPC5. NCBI Entrez Gene ID = SNAPC5...
... monoclonal antibody raised against a partial recombinant NFKBIB. ... a.a. ~ 145 a.a) partial recombinant protein with ... EDGDTALHLAVIHQHEPFLDFLLGFSAGTEYMDLQNDLGQTALHLAAILGETSTVEKLYAAGAGLCVAERRGHTALHLACRVGAHACARA Accession: BC015528 ... OMIM: 604495, ...
... Perm/Wash Buffer I can be used in ... to permeabilize cells and to serve as ... Because saponin-mediated cell permeabilization is a reversible ... cells in the presence of saponin during ...
Biology Products:
(Date:5/23/2017)...  Hunova, the first robotic gym for the rehabilitation and functional motor ... Genoa, Italy . The first 30 robots will be ... USA . The technology was developed and patented at the ... spin-off Movendo Technology thanks to a 10 million euro investment from entrepreneur ... ...
(Date:4/19/2017)... 2017 The global military biometrics ... marked by the presence of several large global players. ... five major players - 3M Cogent, NEC Corporation, M2SYS ... nearly 61% of the global military biometric market in ... global military biometrics market boast global presence, which has ...
(Date:4/11/2017)... April 11, 2017 Crossmatch®, a globally-recognized ... solutions, today announced that it has been awarded ... Projects Activity (IARPA) to develop next-generation Presentation Attack ... "Innovation has been a driving force within ... will allow us to innovate and develop new ...
Breaking Biology News(10 mins):
(Date:8/11/2017)... ... ... Algenist continues to disrupt the skincare industry with today’s debut of GENIUS Liquid ... the key structural element skin needs to maintain its youthful appearance and Algenist is ... First to market with proprietary collagen water active , Active ...
(Date:8/10/2017)... ... August 09, 2017 , ... Teachers from three Philadelphia middle ... 14th through the 16th, the University City Science Center will kick off the ... provides Philadelphia-based middle school educators an opportunity for professional development related to STEM ...
(Date:8/10/2017)... ... August 09, 2017 , ... Okyanos Center for Regenerative Medicine has announced its ... Hotel in Freeport, Grand Bahama on September 27, 2017. This daytime event is free ... from the Ministry of Health’s National Stem Cell Ethics Committee (NSCEC) and regulations laid ...
(Date:8/10/2017)... USA, and CARDIFF, UK (PRWEB) , ... August ... ... and photonics, has announced an agreement establishing Kinokuniya Company Ltd. as its exclusive ... SPIE as the exclusive sales representative for the SPIE Digital Library in Japan. ...
Breaking Biology Technology: