Navigation Links
Goat Anti-Human IL-29 / IFN-lambda 1 Polyclonal Antibody, Biotin Conjugated from R&D Systems

ProductsGoat Anti-Human IL-29 / IFN-lambda 1 Polyclonal Antibody, Biotin Conjugated from R&D Systems
Company R&D Systems
Item Goat Anti-Human IL-29 / IFN-lambda 1 Polyclonal Antibody, Biotin Conjugated
Price $380.00
Description Human IL-29/IFN-lambda 1 Biotinylated Affinity Purified PAb
Info R&D SystemsR&D Systems
R&D Systems, Inc.
614 McKinley Place N.E.
Minneapolis, MN 55413
Customer Service: 1 (800) 343-7475
1 (612) 379-2956

Fax Number: 1 (612) 656-4400
Web Site: http://www.rndsystems.com
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Mouse Anti-Human S-100 alpha/beta chain Monoclonal Antibody, Unconjugated, Clone 8B10 from Santa Cruz Biotechnology, Inc.
2. Rabbit Anti-Human Vitamin K-dependent Protein S (PROS1) Polyclonal Antibody, Unconjugated from Lifespan Biosciences
3. Mouse Anti-Human Complement factor B Monoclonal Antibody, Unconjugated, Clone 9B6 from AntibodyShop A/S
4. Mouse Anti-Human Choriongonadotropin (hCG) Monoclonal Antibody, Unconjugated, Clone 5F10 from AntibodyShop A/S
5. Mouse Anti-Human Procollagen type I C-terminal propeptide (PICP) Monoclonal Antibody, Unconjugated from AntibodyShop A/S
6. Mouse Anti-Human Acetylcholinesterase, brain (AChE) Monoclonal Antibody, Unconjugated, Clone 12B4 from AntibodyShop A/S
7. Mouse Anti-Human a1-Antitrypsin (alpha-1 AT) Monoclonal Antibody, Unconjugated, Clone 4E5 from AntibodyShop A/S
8. Rabbit Anti-Human Sirtuin (silent mating type information regulation 2, S.cerevisiae, homolog) 7 (SIRT7) Polyclonal Antibody, Unconjugated from Lifespan Biosciences
9. Goat Anti-Human RORgamma (S-14) Polyclonal Antibody, Unconjugated from Santa Cruz Biotechnology, Inc.
10. Rabbit Anti-Human Rad51 Polyclonal Antibody, Unconjugated from Abcam
11. Mouse Anti-Human RAD51L3 Monoclonal Antibody, Unconjugated, Clone 1C8-3C11 from Novus Biologicals
... a partial recombinant FES. ... 250 a.a) partial recombinant protein with GST ... WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA Accession: BC035357 ... AAH35357 OMIM: 190030, ...
Mouse monoclonal antibody raised against a partial recombinant PRKG1. NCBI Entrez Gene ID = PRKG1...
... raised against a partial recombinant ... PPP4C (NP_002711, 218 a.a. ... protein with GST tag. ... NM_002720 Protein ...
Mouse monoclonal antibody raised against a full length recombinant GPT. NCBI Entrez Gene ID = GPT...
Biology Products:
(Date:6/20/2016)... 2016 Securus Technologies, a leading provider ... public safety, investigation, corrections and monitoring announced that ... has secured the final acceptance by all three ... Access Systems (MAS) installed. Furthermore, Securus will have ... installed by October, 2016. MAS distinguishes between legitimate ...
(Date:6/15/2016)... York , June 15, 2016 ... new market report titled "Gesture Recognition Market by Application ... Forecast, 2016 - 2024". According to the report, the  ... 11.60 billion in 2015 and is estimated to ... USD 48.56 billion by 2024.  Increasing ...
(Date:6/9/2016)... Paris Police Prefecture and ... ensure the safety of people and operations in several locations ... Teleste, an international technology group specialised in broadband ... its video security solution will be utilised by ... across the country. The system roll-out is scheduled for the ...
Breaking Biology News(10 mins):
(Date:6/23/2016)... , June 23, 2016 Apellis Pharmaceuticals, ... 1 clinical trials of its complement C3 inhibitor, ... and multiple ascending dose studies designed to assess ... of subcutaneous injection in healthy adult volunteers. ... either as a single dose (ranging from 45 ...
(Date:6/23/2016)... -- Andrew D Zelenetz , ... Published recently in Oncology & ... Andrew D Zelenetz , discusses the fact ... placing an increasing burden on healthcare systems worldwide, ... the patents on many biologics expiring, interest in ...
(Date:6/23/2016)... ... June 23, 2016 , ... ClinCapture, the only ... Center and will showcase its product’s latest features from June 26 to June ... scientific poster on Disrupting Clinical Trials in The Cloud during the conference. ...
(Date:6/23/2016)... ... June 23, 2016 , ... Velocity Products, a division of ... and optimized exclusively for Okuma CNC machining centers at The International Manufacturing Technology ... among several companies with expertise in toolholding, cutting tools, machining dynamics and distribution, ...
Breaking Biology Technology: