Navigation Links
Goat Anti-Human FACTOR 8RELATED ANTIGEN Polyclonal Antibody, Unconjugated from AbD Serotec

ProductsGoat Anti-Human FACTOR 8RELATED ANTIGEN Polyclonal Antibody, Unconjugated from AbD Serotec
Company AbD Serotec
Item Goat Anti-Human FACTOR 8RELATED ANTIGEN Polyclonal Antibody, Unconjugated
Price $140.00
Description GOAT ANTI HUMAN FACTOR 8RELATED ANTIGEN
Info AbD SerotecAbD Serotec

UK & Ireland
MorphoSys UK Ltd
Endeavour House
Langford Business Park
Langford Lane
Kidlington
Oxford, OX5 1GF, UK
Tel: +44(0)1865 852 700
Fax: +44(0)1865 852 739
E-mail: sales@ab-direct.com

North & South America
MorphoSys US Inc
3200 Atlantic Avenue, Suite 125
Raleigh, NC 27604, USA
Toll Free: 1-800-265-7376
Tel: 919-878-7978
Fax: 919-878-3751
E-mail: sales.us@ab-direct.com

Scandinavia & Baltic States
MorphoSys UK Ltd (Scandinavia)
Postboks 4079
N-2306 HAMAR, Norway
Tel: +44 (0)1865 852 728
Fax: +44 (0)1865 852 739
E-mail: sales.no@ab-direct.com

France & Belgium
MorphoSys UK Ltd (France)
15 rue des Pas Perdus
BP 38338
95804 Cergy Saint-Christophe
France
Tel: + 33 1 34 25 83 34
Fax: + 33 1 34 25 44 00
E-mail: sales.fr@ab-direct.com

Germany, Netherlands, Austria & Switzerland
MorphoSys AbD GmbH
Immermannstr. 13
D-40210 Dsseldorf
Germany
Tel (General): +49 (0)211 93 503 10
Tel (Technical): +49 (0)211 93 503 11
Fax: +49 (0)211 93 503 12
E-mail: sales.de@ab-direct.com

Worldwide
MorphoSys UK Ltd
Endeavour House
Langford Business Park
Langford Lane
Kidlington
Oxford, OX5 1GF, UK
Tel: +44(0)1865 852 700
Fax: +44(0)1865 852 739
E-mail: sales@ab-direct.com

Customer Service: 1-800-265-7376
Fax Number: 1-919-878-3751
Web Site: www.ab-direct.com
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Mouse Anti-Human S-100 alpha/beta chain Monoclonal Antibody, Unconjugated, Clone 8B10 from Santa Cruz Biotechnology, Inc.
2. Rabbit Anti-Human Vitamin K-dependent Protein S (PROS1) Polyclonal Antibody, Unconjugated from Lifespan Biosciences
3. Mouse Anti-Human Complement factor B Monoclonal Antibody, Unconjugated, Clone 9B6 from AntibodyShop A/S
4. Mouse Anti-Human Choriongonadotropin (hCG) Monoclonal Antibody, Unconjugated, Clone 5F10 from AntibodyShop A/S
5. Mouse Anti-Human Procollagen type I C-terminal propeptide (PICP) Monoclonal Antibody, Unconjugated from AntibodyShop A/S
6. Mouse Anti-Human Acetylcholinesterase, brain (AChE) Monoclonal Antibody, Unconjugated, Clone 12B4 from AntibodyShop A/S
7. Mouse Anti-Human a1-Antitrypsin (alpha-1 AT) Monoclonal Antibody, Unconjugated, Clone 4E5 from AntibodyShop A/S
8. Rabbit Anti-Human Sirtuin (silent mating type information regulation 2, S.cerevisiae, homolog) 7 (SIRT7) Polyclonal Antibody, Unconjugated from Lifespan Biosciences
9. Goat Anti-Human RORgamma (S-14) Polyclonal Antibody, Unconjugated from Santa Cruz Biotechnology, Inc.
10. Rabbit Anti-Human Rad51 Polyclonal Antibody, Unconjugated from Abcam
11. Mouse Anti-Human RAD51L3 Monoclonal Antibody, Unconjugated, Clone 1C8-3C11 from Novus Biologicals
...
... Mouse monoclonal antibody raised against a partial ... (AAH39825, 358 a.a. ~ 457 a.a) partial recombinant ... Sequence: PPKQQSQEKPPQTLFPSIVKNMPTKPNGTLSHKSGRRRWGQTIFKSGDSWEELEDYDFGASHSKKPSMGVFKEKRKKDSPFRQQVKMAVISLSAHQFPTL Accession: ... AAH39825 OMIM: 154235, ...
Mouse monoclonal antibody raised against a full length recombinant PPIL2. NCBI Entrez Gene ID = PPIL2...
Mouse monoclonal antibody raised against a full length recombinant SCGB3A2. NCBI Entrez Gene ID = SCGB3A2...
Biology Products:
(Date:3/20/2017)... HANOVER, Germany , March 20, 2017 At ... Hamburg -based biometrics manufacturer DERMALOG. The Chancellor came to the ... Japan is this year,s CeBIT partner country. At the largest ... important biometrics in use: fingerprint, face and iris recognition as well as ... ...
(Date:3/16/2017)... - Against identity fraud with DERMALOG solutions "Made in Germany "  ... ... multi-biometric solutions provide a crucial contribution against identity fraud. (PRNewsFoto/Dermalog Identification Systems) ... Used combined in one project, multi-biometric solutions provide a crucial contribution against identity ... ...
(Date:3/9/2017)... Australia , March 9, 2017 /PRNewswire/ ... at the prestigious World Lung Imaging Workshop at the ... Fouras , was invited to deliver the latest data ... This globally recognised event brings together leaders at the ... latest developments in lung imaging. "The ...
Breaking Biology News(10 mins):
(Date:3/24/2017)... Md. , March 24, 2017  Infectex Ltd., ... (MBVF), today announced positive results of a Phase 2b-3 ... therapy regimen in patients with multidrug-resistant pulmonary tuberculosis (MDR-TB). ... scientists at Sequella, Inc. ( USA ) ... A total of 140 patients were enrolled in ...
(Date:3/24/2017)... , March 24, 2017 Agenus Inc. ... immune checkpoint antibodies and cancer vaccines, today announced participation ... 7 th  Annual William Blair and Maidstone Life Sciences ... Alexandria Center in New York, NY ... March 29 at 9:40 am: Robert B. ...
(Date:3/23/2017)... March 23, 2017  SeraCare Life Sciences, ... in vitro diagnostics manufacturers and clinical laboratories, ... first multiplexed Inherited Cancer reference material ... by next-generation sequencing (NGS). The Seraseqâ„¢ Inherited Cancer ... input from industry experts to validate the ...
(Date:3/23/2017)... NEW YORK , March 23, 2017 ... ... causes of death, putting significant strain on health care systems, ... of cancer diagnoses rises, so too does the development of ... with minimum side effects. Among the many types of cancer ...
Breaking Biology Technology: