Navigation Links
Goat Anti-HSPC150 Polyclonal Antibody, Unconjugated from Abcam

ProductsGoat Anti-HSPC150 Polyclonal Antibody, Unconjugated from Abcam
Company Abcam
Item Goat Anti-HSPC150 Polyclonal Antibody, Unconjugated
Price 
Description Goat polyclonal to HSPC150 (Abpromise for all tested applications).

entrezGeneID: 29089

Info AbcamAbcam
332 Cambridge Science Park
Milton Road
Cambridge CB4 0FW
UK







Customer Service: +44 (0) 1223 472030
Fax Number: +44 (0) 1223 472038
Web Site: http://www.abcam.com
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Goat Anti-TGase3 (S-20) Polyclonal Antibody, Unconjugated from Santa Cruz Biotechnology, Inc.
2. Rabbit Anti-Aph-1aL, S Loop (92-115) Polyclonal Antibody, Unconjugated from Covance Research Products, Inc
3. Goat Anti-SCCRO (S-17) Polyclonal Antibody, Unconjugated from Santa Cruz Biotechnology, Inc.
4. Rabbit Anti-Human Vitamin K-dependent Protein S (PROS1) Polyclonal Antibody, Unconjugated from Lifespan Biosciences
5. Goat Anti-ZBP-89 (S-15) Polyclonal Antibody, Unconjugated from Santa Cruz Biotechnology, Inc.
6. Goat Anti-XPLAC (S-17) Polyclonal Antibody, Unconjugated from Santa Cruz Biotechnology, Inc.
7. Anti-JIP 1 / 2 (SH3) Polyclonal Antibody, Unconjugated, Clone ZMD.177 from Invitrogen
8. Rabbit Anti-Human Sirtuin (silent mating type information regulation 2, S.cerevisiae, homolog) 7 (SIRT7) Polyclonal Antibody, Unconjugated from Lifespan Biosciences
9. Goat Anti-Human RORgamma (S-14) Polyclonal Antibody, Unconjugated from Santa Cruz Biotechnology, Inc.
10. Rabbit Anti-Esa1 Polyclonal Antibody, Unconjugated from Abcam
11. Rabbit Anti-Human Rad51 Polyclonal Antibody, Unconjugated from Abcam
Agarose II (Low Melt)...
... antibody raised against a partial recombinant FES. ... 120 a.a. ~ 250 a.a) partial recombinant ... Protein Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA ... Accession Number: AAH35357 ...
Mouse monoclonal antibody raised against a partial recombinant ACTN4. NCBI Entrez Gene ID = ACTN4...
Mouse monoclonal antibody raised against a partial recombinant PDE2A. NCBI Entrez Gene ID = PDE2A...
Biology Products:
(Date:12/11/2014)... Minn. , Dec. 10, 2014  Data ... physiologic monitoring, has released a new series of ... of preclinical toxicology researchers. M series, part of ... toxicologists collect the best possible physiologic data when ... Adding functional endpoints to toxicology studies has ...
(Date:12/10/2014)... , Dec. 08, 2014 Research and Markets ... addition of the "Biometrics Market in Japan ... http://photos.prnewswire.com/prnh/20130307/600769 The ... such as rural banking and upgradation of the ... witnessed in the market. Besides the aforementioned projects, ...
(Date:12/3/2014)... , Dec. 2, 2014   Marvin ... deployed, innovative test solutions for military, aerospace, and ... version of its successful TS-900 PXI semiconductor ... and features of high-end systems to customers at ... value compared to traditional ATE. ...
Breaking Biology News(10 mins):New telemetry implants expected to change how large animal toxicology studies are conducted 2Biometrics Market in Japan 2014-2018: Key Vendors are DDS, Fujitsu, Hitachi and NEC 2Marvin Test Solutions Brings New Capabilities to PXI-Based Semiconductor Test with TS-960 2Marvin Test Solutions Brings New Capabilities to PXI-Based Semiconductor Test with TS-960 3
... proteins of human cells infected with a common cold virus ... the genetic information we hold on animals by around 70 ... Methods , could revolutionise our understanding of animal genetics and ... SARS that jump the species barrier from animals to humans. ...
... nuclear magnetic resonance (NMR) technology is capable of detecting ... of blood. Microvesicles shed by cancer cells are even ... detecting them could prove a simple means for diagnosing ... , investigators at the Massachusetts General Hospital (MGH) Center ...
... Nobody knows the remarkable properties of human skin like ... our skin sensitive, sending the brain precise information about ... preserve a protective barrier against the world. Combining these ... exciting challenge for Stanford Chemical Engineering Professor Zhenan Bao ...
Cached Biology News:Scientists discover new method of gene identification 2Detection, analysis of 'cell dust' may allow diagnosis, monitoring of brain cancer 2Detection, analysis of 'cell dust' may allow diagnosis, monitoring of brain cancer 3Touch-sensitive plastic skin heals itself 2Touch-sensitive plastic skin heals itself 3
(Date:12/22/2014)... , Dec. 22, 2014  Alternative Energy ... that it has signed a letter of intent ... has developed and patented a nanotechnology-based development platform ... products that enable rapid on-site collection and testing ... and health issues in an immediate, non-invasive and ...
(Date:12/22/2014)... 2014 The American Journal ... original research, reviews and editorials addressing developments and ... today published a provocative article exploring the role ... and potential treatment of prostate cancer. , ... proposes the possibility that there could be a ...
(Date:12/19/2014)... PA (PRWEB) December 19, 2014 ... leading developer and manufacturer of needle-free injection technology, ... agreement with Immunomic Therapeutics, Inc. (“ITI”) for ITI ... device with its LAMP™ vaccine platform. , ... an exclusive Worldwide license to the Biojector®-2000 that ...
(Date:12/19/2014)... 2014 Naurex Inc., a biopharmaceutical company leveraging ... of the central nervous system, today announced that ... will present at the 33 rd annual J.P. ... at 3:00 p.m. PST on Tuesday, January 13, 2015, ... Francisco, Calif. About Naurex ...
Breaking Biology Technology:ALNE Announces Intention To Acquire BioTechPharma 2Prostate Cancer Experts Dissect the Role of Follicle-stimulating Hormone in the Development, Progression and Potential Treatment of Prostate Cancer 2Prostate Cancer Experts Dissect the Role of Follicle-stimulating Hormone in the Development, Progression and Potential Treatment of Prostate Cancer 3Prostate Cancer Experts Dissect the Role of Follicle-stimulating Hormone in the Development, Progression and Potential Treatment of Prostate Cancer 4Bioject and Immunomic Therapeutics Enter into an Agreement for License of Needle-Free Technology for LAMP-vax Vaccines 2Bioject and Immunomic Therapeutics Enter into an Agreement for License of Needle-Free Technology for LAMP-vax Vaccines 3Naurex to Present at 33rd Annual J.P. Morgan Healthcare Conference 2