Navigation Links
Goat Anti-Cholesterol Oxidase Polyclonal Antibody, Unconjugated from GeneTex

ProductsGoat Anti-Cholesterol Oxidase Polyclonal Antibody, Unconjugated from GeneTex
Company GeneTex
Item Goat Anti-Cholesterol Oxidase Polyclonal Antibody, Unconjugated
Price $250.00
Description Product Goat polyclonal to Cholesterol Oxidase
Immunogen Cholesterol Oxidase (Microorganism).
Reactivity / Specificity Cross-reacts with bacteria. Not yet tested in other species.
Background Information Cholesterol oxidases exist as both type I and type II oxidases and are implicated in bacterial pathogenesis. In addition, they are important as clinical reagents, potential larvicides, and tools in cell biology.
Info GeneTexGeneTex
14785 Omicron Dr. Suite101
San Antonio, TX 78245
Customer Service: (877) 436-3839
Fax Number: (210) 677-8843
Web Site: http://www.genetex.com
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Goat Anti-Microbial Sarcosine Oxidase Polyclonal Antibody, Unconjugated from Abcam
2. Rabbit Anti-Bovine Xanthine Oxidase, Buttermilk Polyclonal Antibody, Horseradish Peroxidase Conjugated from Meridian Life Science, Inc.
3. Rabbit Anti-Bovine Xanthine Oxidase, Buttermilk Polyclonal Antibody, Unconjugated from Meridian Life Science, Inc.
4. Mouse Anti-Human Xanthine Oxidase / Aldehyde Oxidase Ab-2 Mouse Monoclonal Antibody, Biotin Conjugated, Clone 145.4 from Lab Vision
5. Anti-Xanthine Oxidase, Buttermilk Polyclonal Antibody, Unconjugated from CHEMICON
6. Goat Anti-Sarcosine Oxidase Polyclonal Antibody, HRP Conjugated from Abcam
7. Rabbit Anti-Cow Xanthine Oxidase Polyclonal Antibody, HRP Conjugated from Abcam
8. Mouse Anti-Xanthine Oxidase Prediluted Monoclonal Antibody, Unconjugated, Clone SPM325 from Abcam
9. Goat Anti-TGase3 (S-20) Polyclonal Antibody, Unconjugated from Santa Cruz Biotechnology, Inc.
10. Rabbit Anti-Aph-1aL, S Loop (92-115) Polyclonal Antibody, Unconjugated from Covance Research Products, Inc
11. Goat Anti-SCCRO (S-17) Polyclonal Antibody, Unconjugated from Santa Cruz Biotechnology, Inc.
... Lines ,High Quality, Functionally-Validated, Ion Channel Cell ... for having a critical role in nerve ... key function in pain, CNS and the ... been investigated in therapeutic areas, such as ...
Mouse monoclonal antibody raised against a partial recombinant CHD8. NCBI Entrez Gene ID = CHD8...
Mouse monoclonal antibody raised against a partial recombinant PASK. NCBI Entrez Gene ID = PASK...
... Mouse monoclonal antibody raised against a partial recombinant ... 56 a.a. ~ 145 a.a) partial recombinant protein ... EDGDTALHLAVIHQHEPFLDFLLGFSAGTEYMDLQNDLGQTALHLAAILGETSTVEKLYAAGAGLCVAERRGHTALHLACRVGAHACARA Accession: BC015528 ... OMIM: 604495, ...
Biology Products:
(Date:4/11/2017)... -- NXT-ID, Inc. (NASDAQ:   NXTD ) ("NXT-ID" ... of independent Directors Mr. Robin D. Richards and ... furthering the company,s corporate governance and expertise. ... Gino Pereira , Chief Executive Officer ... guidance and benefiting from their considerable expertise as we move ...
(Date:4/4/2017)... , April 4, 2017   EyeLock LLC , ... that the United States Patent and Trademark Office (USPTO) ... covers the linking of an iris image with a ... and represents the company,s 45 th issued patent. ... is very timely given the multi-modal biometric capabilities that ...
(Date:3/29/2017)... March 29, 2017  higi, the health IT company ... North America , today announced a Series ... acquisition of EveryMove. The new investment and acquisition accelerates ... tools to transform population health activities through the collection ... higi collects and secures data today on ...
Breaking Biology News(10 mins):
(Date:10/12/2017)... ... October 12, 2017 , ... ... genomics analysis platform specifically designed for life science researchers to analyze and ... researcher Rosalind Franklin, who made a major contribution to the discovery of ...
(Date:10/11/2017)... ... October 11, 2017 , ... Personal eye wash is a basic first aid supply for any ... So which eye do you rinse first if a dangerous substance enters both eyes? It’s ... Wash with its unique dual eye piece. , “Whether its dirt and debris, or ...
(Date:10/11/2017)... BioMarketing, a leading provider of patient support solutions, has announced ... network, which will launch this week. The VMS CNEs will ... to enhance the patient care experience by delivering peer-to-peer education ... professionals to help women who have been diagnosed and are ... ...
(Date:10/11/2017)... ... 11, 2017 , ... A new study published in Fertility ... fresh in vitro fertilization (IVF) transfer cycles. The multi-center matched cohort ... After comparing the results from the fresh and frozen transfer cohorts, the authors ...
Breaking Biology Technology: