Navigation Links
GeneTraffic from Iobion Informatics

ProductsGeneTraffic from Iobion Informatics
Company Iobion Informatics
Item GeneTraffic
Price Inquire
Description Ease of Use: GeneTraffic is built to be a straightforward, intuitive software tool for biological research. GeneTraffic provides visual and computational tools to allow you to validate your data prior to analysis.
Data and Project Management: Quickly define your projects using the MIAME (Minimum Information About a Microarray Experiment) standard. Load data and image files into the database once back them up, keep them safe, together and always accessible.
Accessible:Access and share your GeneTraffic data from any PC on your Local Area Web.
Analysis: Intuitive, graphical selection of filter and normalization criteria. Perform data classification tasks, including k-means and hierarchical cluster analyses, on data youve mined using gene and spot parameters or data-specific values.
Low Investment, High Return: Weve kept the cost down by building GeneTraffic on the solid, reliable Open Source foundation: LINUX, the R statistical language, PostgreSQL, and Apache Web server. GeneTraffic software creates a LINUX Appliance out of an affordable off-the shelf workstation computer. This approach keeps the cost of the software down and support and maintenance issues low. You can focus on the biological aspects of your Microarray research and yet run an enterprise-strength client- server data management and analysis system.
Info Iobion InformaticsIobion Informatics
Iobion Informatics LLC
11011 North Torrey Pines Road
La Jolla, CA 92037
Customer Service: 877-837-1941
Fax Number: 512-321-3128
Web Site: http://www.iobion.com
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. GeneTraffic from Iobion Informatics
2. Acuity Enterprise Microarray Informatics Software from Molecular Devices
... raised against a partial recombinant FES. ... a.a. ~ 250 a.a) partial recombinant protein ... Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA Accession: ... Number: AAH35357 OMIM: ...
Mouse polyclonal antibody raised against a partial recombinant PREB. NCBI Entrez Gene ID = 10113...
Mouse monoclonal antibody raised against a full length recombinant GPT. NCBI Entrez Gene ID = GPT...
Rabbit polyclonal antibody to GluR2...
Biology Products:
(Date:6/19/2013)... MOUNTAIN VIEW, Calif. , June 20, 2013 ... the personalized cosmeceuticals market, Frost & Sullivan recognizes ... Sullivan Award for New Product Innovation. geneOnyx leverages ... point-of-care testing to create an on-the-spot genetic test ... only a single-step DNA collection procedure from saliva ...
(Date:6/19/2013)... is playing a vital role in the survival of ... to climate and environmental changes, according to new research ... savannah birds from the Tanzanian Bird Atlas project - ... - the researchers found that they are using protected ... further west where dry seasons are getting longer, with ...
(Date:6/19/2013)... 19, 2013   Mercy Medical Center ... technology for conducting on-demand, Hemoglobin A 1c ... well as analysis of important red blood ... The new system enables the hospital to ... physicians and their patients, which can improve ...
Breaking Biology News(10 mins):Frost & Sullivan Applauds geneOnyx for its DNA Testing Solution for the Personalized Cosmeceuticals Market 2Frost & Sullivan Applauds geneOnyx for its DNA Testing Solution for the Personalized Cosmeceuticals Market 3Frost & Sullivan Applauds geneOnyx for its DNA Testing Solution for the Personalized Cosmeceuticals Market 4Protected areas provide African birds with stepping stones to survival 2Mercy Lab Offers Faster On-demand Diabetes Testing, Cellular Studies 2Mercy Lab Offers Faster On-demand Diabetes Testing, Cellular Studies 3Mercy Lab Offers Faster On-demand Diabetes Testing, Cellular Studies 4
... in biomedical science are on the horizon with ... Infrastructure (Instruct) in support of European biomedical research. ... (ESFRI) is involved in establishing about 40 such ... is one such biomedical project, whose aim is ...
... center responsible for responding goes into gear, setting off a ... from the adrenal glands. Dr. Gil Levkowitz ... now revealed a new kind of ON-OFF switch in the ... from the brain that stimulates cortisol release in the body. ...
... by a University of California, Davis, plant scientist delivers a ... world-renowned wine industry. The study is set for publication ... the Proceedings of the National Academy of Sciences. "Many ... plant, but we believe that most microbes would have difficulty ...
Cached Biology News:European Integrated Structural Biology Infrastructure launching 2A unique on-off switch for hormone production 2Fused genes tackle deadly Pierce's disease in grapevines 2
(Date:6/19/2013)... 19, 2013  Continuing its long history of proven ... Beckman Coulter , Inc. announces the U.S. Food and ... AccuTnI+3 troponin I assay for use on its Access ... on Beckman Coulter,s troponin I test for ... the proven performance to continue providing dependability to laboratories ...
(Date:6/19/2013)... Bayer CropScience will honor Illinois beekeeper Steve McNair ... Award. The award will be announced at Bayer’s ... an event where supporters of pollinator health celebrate the ... , The Bayer Bee Care Community Leadership Award recognizes ... bee colony to benefit their community. Applicants are judged ...
(Date:6/19/2013)... LOS ANGELES , June 19, 2013 Biotechnology ... is teaming up with financial software provider BlackLine Systems ... (NYSE: SAP ) for a webinar next week ... Amgen Uses Solutions from BlackLine and SAP to Help Keep ... (Logo: http://photos.prnewswire.com/prnh/20061117/LAF027LOGO ) The webinar, ...
(Date:6/19/2013)... Indiana (PRWEB) June 19, 2013 ... joined the speaking faculty at 2013’s BioLogistics Summit ... The conference, coordinated by Cold Chain IQ and ... biologics. This “complexity” is, in part, attributed to ... , “Implicit within these trends is an ...
Breaking Biology Technology:Beckman Coulter Announces FDA Clearance of New Access AccuTnI+3 Troponin I Assay for the Access 2 Immunoassay System 2Beckman Coulter Announces FDA Clearance of New Access AccuTnI+3 Troponin I Assay for the Access 2 Immunoassay System 3Community Mentor Wins Inaugural Bayer CropScience Bee Care Leadership Award 2Community Mentor Wins Inaugural Bayer CropScience Bee Care Leadership Award 3Community Mentor Wins Inaugural Bayer CropScience Bee Care Leadership Award 4Amgen Joins BlackLine Systems, SAP for Webinar on Automating Account Reconciliations 2Amgen Joins BlackLine Systems, SAP for Webinar on Automating Account Reconciliations 3Amgen Joins BlackLine Systems, SAP for Webinar on Automating Account Reconciliations 4BioConvergence® Presents at BioLogistics Summit on Risk Matrix for Biosamples during Shipment 2