Navigation Links
Gene Cycler Thermal Cycler from Bio-Rad

ProductsGene Cycler Thermal Cycler from Bio-Rad
Company Bio-Rad
Item Gene Cycler Thermal Cycler
Price 
Description The Gene Cycler unit is an inexpensive personal or mini thermal cycler, and is fully licensed for the PCR process. Lightweight, with a small footprint, it can be easily transported and fits almost anywhere, including the researcher's desk.

The Gene Cycler thermal cycler meets the needs of researchers who do not have access to a large laboratory thermal cycler, or those who do not have the budget to acquire another expensive laboratory thermal cycler.

The Gene Cycler is an advanced solid-state thermal cycler which features oil-free operation. It uses electrical resistors for heating and a fan for cooling, resulting in fast ramping times. The temperature displayed corresponds to the temperature inside the tube, because the cycler uses software algorithms that compensate for temperature differences between the heating block and the sample. Temperature uniformity in all samples is ensured by even distribution of the electrical resistors throughout the heating block, and sample evaporation is avoided by keeping the block lid at a higher temperature than the samples. The cycler has the ability to link up to 6 programs and still provides enough memory to store up to 100 programs.

Info Bio-RadBio-Rad
Bio-Rad Laboratories, Inc.
Life Science Research Group
2000 Alfred Nobel Drive
Hercules, CA 94547
USA
Customer Service: 800-424 6723
Fax Number: 800-879 2289
Web Site: http://discover.bio-rad.com
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Applied Biosystems 2720 Thermal Cycler from Applied Biosystems
2. RapidCycler 2 Instrument from Idaho Technology Inc.
3. OmniSlide thermal Cycler from Thermo Scientific
4. MBS Thermal Cycler 2 Block Laptop Kit from Thermo Scientific
5. MBS Satellite Thermal Cycler from Thermo Scientific
6. Robotic MBS Thermal Cycler 384 Well from Thermo Scientific
7. MBS Satellite Thermal Cycler 384 Well from Thermo Scientific
8. Robotic MBS Thermal Cycler 0.2 ml from Thermo Scientific
9. PxE Thermal Cycler 0.5ml from Thermo Scientific
10. Px2 Thermal Cycler from Thermo Scientific
11. PxE Thermal Cycler from Thermo Scientific
... antibody raised against a partial recombinant FES. ... 120 a.a. ~ 250 a.a) partial recombinant ... Protein Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA ... Accession Number: AAH35357 ...
... Mouse polyclonal antibody raised against ... Immunogen: PPP4C ... a.a) partial recombinant protein with ... Accession Number: NM_002720 ...
Mouse monoclonal antibody raised against a partial recombinant CAPG. NCBI Entrez Gene ID = CAPG...
...
Biology Products:
(Date:4/15/2016)... , April 15, 2016  A new ... make more accurate underwriting decisions in a fraction ... timely, competitively priced and high-value life insurance policies ... screenings. With Force Diagnostics, rapid testing ... lifestyle data readings (blood pressure, weight, pulse, BMI, ...
(Date:3/31/2016)... BOCA RATON, Florida , March 31, 2016 /PRNewswire/ ... LEGX ) ("LegacyXChange" or the "Company") ... presentation for potential users of its soon to be ... The video ( https://www.youtube.com/channel/UCyTLBzmZogV1y2D6bDkBX5g ) will also ... by the use of DNA technology to an industry ...
(Date:3/22/2016)... PUNE, India , March 22, 2016 ... new market research report "Electronic Sensors Market for ... Fingerprint, Proximity, & Others), Application (Communication & ... and Geography - Global Forecast to 2022", ... consumer industry is expected to reach USD ...
Breaking Biology News(10 mins):
(Date:6/24/2016)... Epic Sciences unveiled a liquid biopsy ... PARP inhibitors by targeting homologous recombination deficiency (HRD) ... test has already been incorporated into numerous clinical ... Over 230 clinical trials are investigating ... PARP, ATM, ATR, DNA-PK and WEE-1. Drugs targeting ...
(Date:6/23/2016)... ... June 23, 2016 , ... Mosio, a ... eBook, “Clinical Trials Patient Recruitment and Retention Tips.” Partnering with experienced clinical research ... by providing practical tips, tools, and strategies for clinical researchers. , “The landscape ...
(Date:6/23/2016)... , June 23, 2016 /PRNewswire/ - FACIT has ... Ontario biotechnology company, Propellon Therapeutics Inc. ... and commercialization of a portfolio of first-in-class WDR5 ... targets such as WDR5 represent an exciting class ... in precision medicine for cancer patients. Substantial advances ...
(Date:6/23/2016)... Lawrence, MA (PRWEB) , ... June 23, 2016 ... ... the Peel Plate® YM (Yeast and Mold) microbial test has received AOAC Research ... test platform of microbial tests introduced last year,” stated Bob Salter, Vice President ...
Breaking Biology Technology: